BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1564 (769 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117204-34|CAB55140.2| 348|Caenorhabditis elegans Hypothetical... 31 1.2 Z81555-7|CAB04518.1| 561|Caenorhabditis elegans Hypothetical pr... 29 2.8 >AL117204-34|CAB55140.2| 348|Caenorhabditis elegans Hypothetical protein Y116A8C.40 protein. Length = 348 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 193 LLTYIRLKLIKAYLNVFYRLVCYISRFRGSFSMLVMLSETI 315 +LTY+ L L V+ L+CYIS F +S+ M++E I Sbjct: 18 VLTYLILSKSPKKLGVYKYLMCYISLFEVYYSIWDMMTEPI 58 >Z81555-7|CAB04518.1| 561|Caenorhabditis elegans Hypothetical protein F58E10.3a protein. Length = 561 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +1 Query: 364 LVPCENSLFF--VVVDGKRVYDSRPWTSATPETQQSRCVPRTIFKTNFKRTRHRVH 525 L P E + V + Y+ W SA T + R VPR +F+ N ++H Sbjct: 87 LTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIH 142 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,975,100 Number of Sequences: 27780 Number of extensions: 304040 Number of successful extensions: 1073 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1073 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -