BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1561 (829 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0442 + 3495333-3496484 30 2.6 >12_01_0442 + 3495333-3496484 Length = 383 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +2 Query: 80 VTRSKRYTGADRRKTARAC*RPPKRPSSAKTRVQTKLTRPR----CSQGSVKDTPKYSE 244 VTR R A A A PP +P+S KT+ + K +P+ C +TP++ E Sbjct: 203 VTRPPRTKQAPPTAPAPAPPPPPPQPASPKTKTKAKAKKPKRKRSCVHCGSTETPQWRE 261 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,596,951 Number of Sequences: 37544 Number of extensions: 411404 Number of successful extensions: 954 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 954 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2279943096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -