BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1560 (830 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42848-3|AAA83609.1| 693|Caenorhabditis elegans Hypothetical pr... 29 3.1 Z46266-9|CAO78710.1| 790|Caenorhabditis elegans Hypothetical pr... 28 7.1 >U42848-3|AAA83609.1| 693|Caenorhabditis elegans Hypothetical protein C31H1.1 protein. Length = 693 Score = 29.5 bits (63), Expect = 3.1 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +1 Query: 208 YYLKAI*TLKSIRRNWFNFNKRSFGFDVLN*FISTVYNENN 330 + LKA+ TL+ +N N +K S VLN F+ TV ++ + Sbjct: 20 HQLKALQTLQKYVKNIENISKESINRSVLNNFLETVVHQKS 60 >Z46266-9|CAO78710.1| 790|Caenorhabditis elegans Hypothetical protein ZK899.8j protein. Length = 790 Score = 28.3 bits (60), Expect = 7.1 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 190 NRGKNVIAFFLWTFKKISHNHLCYSVFNFGRYLNYS 83 N+ KNV+ F+W+F K+ N++ S FG Y Y+ Sbjct: 41 NKIKNVLKNFIWSF-KLKKNYVRVSSL-FGEYCRYT 74 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,762,302 Number of Sequences: 27780 Number of extensions: 320718 Number of successful extensions: 642 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 642 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2061488408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -