BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1560 (830 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g25520.2 68418.m03037 transcription elongation factor-related... 29 5.0 At5g64820.1 68418.m08155 hypothetical protein 28 8.7 >At5g25520.2 68418.m03037 transcription elongation factor-related contains weak similarity to transcription elongation factors Length = 997 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -3 Query: 756 ALLSIPNTRHRPRQKRQSSVTLTRHSPLS 670 A+++ P +RH+P KRQ S T T+ S L+ Sbjct: 800 AVVASPGSRHKPGFKRQHSSTGTKRSVLA 828 >At5g64820.1 68418.m08155 hypothetical protein Length = 145 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -3 Query: 813 NEQPPSSWTLSFGSSQSLSALLSIPNTRHRPRQKRQS 703 N+ PPSSW L G+ Q + L PN R + + Sbjct: 53 NKFPPSSWELIQGAMQKIQMKLYPPNLDFRSNSDKSN 89 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,674,955 Number of Sequences: 28952 Number of extensions: 288670 Number of successful extensions: 630 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -