BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1558X (478 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25557| Best HMM Match : HECT (HMM E-Value=0) 62 3e-10 SB_12797| Best HMM Match : HECT (HMM E-Value=0) 43 1e-04 SB_57295| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_25423| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_44630| Best HMM Match : HECT (HMM E-Value=0) 39 0.002 SB_5238| Best HMM Match : HECT (HMM E-Value=0) 38 0.003 SB_35146| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.013 SB_51591| Best HMM Match : HECT (HMM E-Value=0) 36 0.017 SB_53819| Best HMM Match : HECT (HMM E-Value=4e-07) 36 0.023 SB_20163| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.030 SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.039 SB_19076| Best HMM Match : HECT (HMM E-Value=0) 33 0.16 SB_19247| Best HMM Match : HECT (HMM E-Value=5.3) 32 0.28 SB_46466| Best HMM Match : Neur_chan_memb (HMM E-Value=4.8) 32 0.28 SB_13743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.49 SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_22229| Best HMM Match : Arm (HMM E-Value=0) 29 1.5 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 28 3.4 SB_49286| Best HMM Match : Laminin_N (HMM E-Value=0) 28 4.5 SB_33518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_9642| Best HMM Match : PSI (HMM E-Value=3.6) 27 6.0 SB_27055| Best HMM Match : PWI (HMM E-Value=3.5e-08) 27 7.9 >SB_25557| Best HMM Match : HECT (HMM E-Value=0) Length = 454 Score = 61.7 bits (143), Expect = 3e-10 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +1 Query: 256 LDPDEYLPSVMTCVNYLKLPDYSSAEVMXAKLRLAASE 369 L D YLPSVMTCVNYLKLPDY+S E+M KLR AA E Sbjct: 290 LSADNYLPSVMTCVNYLKLPDYTSKEIMLDKLRTAAHE 327 Score = 30.3 bits (65), Expect = 0.85 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +2 Query: 200 GFKALTPPLTVVRKSLE 250 GF++L PPLT+VRK+ E Sbjct: 271 GFRSLNPPLTIVRKTFE 287 >SB_12797| Best HMM Match : HECT (HMM E-Value=0) Length = 749 Score = 43.2 bits (97), Expect = 1e-04 Identities = 22/61 (36%), Positives = 32/61 (52%) Frame = +2 Query: 32 QRWDPRMLAECIRPDHGYNAESRAIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKA 211 Q +D L + D G +S IR +I+ S++ E++R L F TGS R+P GG Sbjct: 637 QDFDFDALEKATEYDGGLTKDSALIRWFWEIVHSFDMEQKRQLLMFTTGSDRIPVGGLAK 696 Query: 212 L 214 L Sbjct: 697 L 697 Score = 30.3 bits (65), Expect = 0.85 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 274 LPSVMTCVNYLKLPDYSSAEVMXAKLRLAASEGQ 375 LP+ TC N L LPDY++ E + +L A + + Sbjct: 711 LPTAHTCFNVLLLPDYATKEKLEERLLKAITHAK 744 >SB_57295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1320 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/37 (51%), Positives = 25/37 (67%) Frame = +2 Query: 122 ILASYNREEQRHFLQFVTGSPRLPTGGFKALTPPLTV 232 I++S +EE LQFVTGS +LP GGF L+P L + Sbjct: 836 IVSSLTQEELARLLQFVTGSSQLPPGGFAELSPQLQI 872 >SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 77 HGYNAESRAIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 H YN S I+ L S+++ + FLQFVTG+ ++P GF AL Sbjct: 2396 HQYNENSLQIQWFWRALRSFDQAARAKFLQFVTGTSKVPLQGFAAL 2441 >SB_25423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 528 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +1 Query: 265 DEYLPSVMTCVNYLKLPDYSSAEVMXAKLRLAASEGQHSFHLS 393 ++ LPS TC+N LKLP+Y + E+M +L A G F LS Sbjct: 487 EDRLPSASTCMNMLKLPEYPTDEMMRERLLYAVESGA-GFELS 528 >SB_44630| Best HMM Match : HECT (HMM E-Value=0) Length = 1003 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 74 DHGYNAESRAIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKALT 217 D GY+A+ I+M ++ +++ L FVTGS R+P G LT Sbjct: 905 DDGYSAQHSTIKMFWNVFNEMTNHQKKALLMFVTGSDRVPLKGLSNLT 952 Score = 32.3 bits (70), Expect = 0.21 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 274 LPSVMTCVNYLKLPDYSSAEVMXAKLRLAASEGQHSFHLS 393 LP+ MTC N L LP+Y+S + + +L + A E F L+ Sbjct: 965 LPTAMTCFNRLLLPEYTSPKRLKERL-IVAIENSKGFGLT 1003 >SB_5238| Best HMM Match : HECT (HMM E-Value=0) Length = 212 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +2 Query: 83 YNAESRAIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 Y S+ + + +Y+ E++ LQFVTG+ RLP GGF L Sbjct: 111 YTRNSKQVMWFWQAVKAYDNEKRIRLLQFVTGTCRLPVGGFTEL 154 Score = 31.1 bits (67), Expect = 0.49 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 Query: 265 DEYLPSVMTCVNYLKLPDYSSAEVMXAKLRLAASE 369 + +LP TC N L LP Y S E + KL A E Sbjct: 171 ETWLPRSHTCFNRLDLPPYKSYEQLVEKLTFAIEE 205 >SB_35146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 262 PDEYLPSVMTCVNYLKLPDYSSAEVMXAKLRLA 360 PD YLP TC LK+P YSS ++ KL+ A Sbjct: 8 PDHYLPESYTCFFLLKMPRYSSHRILCEKLKYA 40 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 37.5 bits (83), Expect = 0.006 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +1 Query: 262 PDEYLPSVMTCVNYLKLPDYSSAEVMXAKLRLA 360 PD YLP TC LK+P YSS ++ KL+ A Sbjct: 3529 PDHYLPESYTCFFLLKMPRYSSHRILCEKLKYA 3561 >SB_47662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 36.3 bits (80), Expect = 0.013 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 80 GYNAESRAIRMLIDILASYNREEQRHFLQFVTGSPRLPTGG 202 GY+ IR D + ++N + ++ L F TGS R+P GG Sbjct: 187 GYSKNDNTIRYFWDTVMNFNTDLKKKMLLFATGSDRIPIGG 227 >SB_51591| Best HMM Match : HECT (HMM E-Value=0) Length = 694 Score = 35.9 bits (79), Expect = 0.017 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = +2 Query: 80 GYNAESRAIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 G I L +AS EE+ L+F TGSP +P GGF AL Sbjct: 591 GCKESDEIITWLWKTIASLKEEEKALLLKFSTGSPCVPIGGFAAL 635 Score = 32.7 bits (71), Expect = 0.16 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 274 LPSVMTCVNYLKLPDYSSAEVMXAKLRLAASEGQHSF 384 +P TC N LKL +Y S + + KL +A G F Sbjct: 655 IPEASTCFNLLKLTNYESEKQLREKLLIAIRHGSEGF 691 >SB_53819| Best HMM Match : HECT (HMM E-Value=4e-07) Length = 279 Score = 35.5 bits (78), Expect = 0.023 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 77 HGYNAESRAIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 H YN S I+ L S+++ + FLQFVTG+ ++P GF AL Sbjct: 156 HKYNENS--IQWFWRALRSFDQAARAKFLQFVTGTSKVPLQGFAAL 199 >SB_20163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 35.1 bits (77), Expect = 0.030 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +2 Query: 131 SYNREEQRHFLQFVTGSPRLPTGGFKAL 214 +Y+ E++ LQFVTG+ RLP GGF L Sbjct: 62 AYDNEKRIRLLQFVTGTCRLPVGGFTEL 89 >SB_55819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2408 Score = 34.7 bits (76), Expect = 0.039 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 6/46 (13%) Frame = +1 Query: 241 IAGVLLDPDEY------LPSVMTCVNYLKLPDYSSAEVMXAKLRLA 360 + G+ L PD+ LP+ TC L+LP YSS E M +LR A Sbjct: 2094 LVGIPLTPDDIEEGVDSLPTAQTCFFQLRLPPYSSQEAMANRLRYA 2139 >SB_19076| Best HMM Match : HECT (HMM E-Value=0) Length = 2018 Score = 32.7 bits (71), Expect = 0.16 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +1 Query: 265 DEYLPSVMTCVNYLKLPDYSSAEVMXAKLRLA 360 D LP+ TC++ L +P YSS ++ +KL LA Sbjct: 1978 DHQLPTANTCISRLYMPLYSSRAILKSKLLLA 2009 >SB_19247| Best HMM Match : HECT (HMM E-Value=5.3) Length = 158 Score = 31.9 bits (69), Expect = 0.28 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 274 LPSVMTCVNYLKLPDYSSAEVMXAKLRLAA 363 LP TC + L LP YSSA+V K+R A+ Sbjct: 114 LPEAATCSSTLFLPKYSSAKVAEEKIRYAS 143 Score = 31.1 bits (67), Expect = 0.49 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +2 Query: 98 RAIRMLIDILASYNREEQRHFLQFVTGSPRLP 193 R I+ L + L ++ E++ FL+FVTG RLP Sbjct: 38 RRIKDLWNALENFTNEDRSRFLRFVTGRRRLP 69 >SB_46466| Best HMM Match : Neur_chan_memb (HMM E-Value=4.8) Length = 498 Score = 31.9 bits (69), Expect = 0.28 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 3/78 (3%) Frame = -2 Query: 225 SGGVNA-LNPPVGSLGLPVTNCKKCRCSSRLYEAKISISMRIARDSALYP*SGRIHSASI 49 SGG + L PP S ++CK ++ ++ K ++ RI+ + P S HSAS+ Sbjct: 91 SGGSDVILYPPKSSATFTSSSCKPPESETQEFQEKNALEARISGEGT--PISMSNHSASL 148 Query: 48 RGSHRWSR--PPEGLPRN 1 S S PP G+P N Sbjct: 149 SSSTASSSSFPPCGVPSN 166 >SB_13743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 31.1 bits (67), Expect = 0.49 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 83 YNAESRAIRMLIDILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 Y+ + I+ + S++ E + LQFVTG+ R+P GF L Sbjct: 467 YHDKHIVIQWFWKAVNSFDIETRARLLQFVTGTSRVPMNGFSEL 510 >SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3408 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 283 VMTCVNYLKLPDYSSAEVMXAKLRLA 360 V TC+ +KLP YS+ E+M +KL A Sbjct: 3372 VETCMFMIKLPPYSTQEIMTSKLLYA 3397 >SB_22229| Best HMM Match : Arm (HMM E-Value=0) Length = 1050 Score = 29.5 bits (63), Expect = 1.5 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = -3 Query: 101 PAILHCIHDPDEYI 60 PA+L+C+ DPDEY+ Sbjct: 252 PAVLNCLKDPDEYV 265 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = +3 Query: 3 YAEVLQVDVTNDG---IHVCWRNVFVRIMDTMQNRGLYACLLIFWLRTTVKNNDTSYSLL 173 + +L +T G + + N ++R+ + QN ++A + L + V +SYS Sbjct: 1078 FVRILNSSITKSGERAVKLDGSNRYMRVDLSAQN-SVFAYNKLGCLYSFVSYYHSSYSAR 1136 Query: 174 LEVQGCQLVDSRH 212 +E CQ++ +RH Sbjct: 1137 VEFASCQIIQNRH 1149 >SB_49286| Best HMM Match : Laminin_N (HMM E-Value=0) Length = 1465 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -2 Query: 198 PVGSLGLPVTNCKKCRCSSRLYEAKISISMRIARD 94 P+G G P T C+KC CS + I R+ D Sbjct: 795 PMGKRGAPTT-CQKCNCSGNIDPNAIGSCDRLTGD 828 >SB_33518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +2 Query: 17 SGGRDQRWDPRMLAECIRPDHGYNAESRAIRMLIDILASYNREEQR 154 SG + W + P +GY+ ES + +++LAS ++++ Sbjct: 20 SGEQVPEWTREDILNYTEPKYGYSKESPGFQRFVNVLASMEGDDRK 65 >SB_9642| Best HMM Match : PSI (HMM E-Value=3.6) Length = 165 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 164 VRSVVVLHGCTKPKYQ*ACV*PAILHCI 81 V V+ G T P + C+ PA+LHC+ Sbjct: 81 VAQVIRQSGTTGPTFNQRCLQPALLHCL 108 >SB_27055| Best HMM Match : PWI (HMM E-Value=3.5e-08) Length = 677 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 83 IHDPDEYIPPAYVDPIVGHVHLKDFRV 3 + D DE +PPA +P+ G HL +V Sbjct: 121 LKDDDEPLPPAIPEPMDGPTHLNSSQV 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,779,589 Number of Sequences: 59808 Number of extensions: 310934 Number of successful extensions: 796 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -