BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1558X (478 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 36 5e-04 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 1.4 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.8 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 4.1 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 23 7.2 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 7.2 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 23 7.2 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 23 7.2 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 23 7.2 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.2 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 7.2 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 36.3 bits (80), Expect = 5e-04 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +2 Query: 122 ILASYNREEQRHFLQFVTGSPRLPTGGFKAL 214 I+ SY+ E + LQFVTGS R+P GF+AL Sbjct: 804 IVESYSPEMRAQLLQFVTGSCRVPLQGFRAL 834 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 25.0 bits (52), Expect = 1.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 252 DSSDLRTTVSGGVNALNPPVGS 187 D LR VS NA++PP GS Sbjct: 818 DPQKLRIVVSKSANAMHPPRGS 839 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.6 bits (51), Expect = 1.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 228 LWCVNRWSLIGSG*IFAISDDMCQLL 305 LW V+ W IG+G + DDM +L Sbjct: 1379 LWIVSFWVRIGNGEMVPKVDDMLNVL 1404 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 23.4 bits (48), Expect = 4.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 80 HDPDEYIPPAYVDP 39 HDPD Y PA DP Sbjct: 416 HDPDIYPEPATYDP 429 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 11 SPSGGRDQRWDPRMLAECIRPDHGYNAESRAI 106 SP+ GR Q + + + P GY E R I Sbjct: 54 SPAYGRSQAYTQQPAPVPLAPRFGYGEEDRLI 85 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 11 SPSGGRDQRWDPRMLAECIRPDHGYNAESRAI 106 SP+ GR Q + + + P GY E R I Sbjct: 54 SPAYGRSQAYTQQPAPVPLAPRFGYGEEDRLI 85 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 11 SPSGGRDQRWDPRMLAECIRPDHGYNAESRAI 106 SP+ GR Q + + + P GY E R I Sbjct: 54 SPAYGRSQAYTQQPAPVPLAPRFGYGEEDRLI 85 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 11 SPSGGRDQRWDPRMLAECIRPDHGYNAESRAI 106 SP+ GR Q + + + P GY E R I Sbjct: 54 SPAYGRSQAYTQQPAPVPLAPRFGYGEEDRLI 85 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 22.6 bits (46), Expect = 7.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 244 AGVLLDPDEYLPSVMTCVNYLKL 312 A ++ DP ++ S + VNYLK+ Sbjct: 482 AKIVFDPKSFILSPVPPVNYLKV 504 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 11 SPSGGRDQRWDPRMLAECIRPDHGYNAESRAI 106 SP+ GR Q + + + P GY E R I Sbjct: 126 SPAYGRSQAYTQQPAPVPLAPRFGYGEEDRLI 157 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 11 SPSGGRDQRWDPRMLAECIRPDHGYNAESRAI 106 SP+ GR Q + + + P GY E R I Sbjct: 125 SPAYGRSQAYTQQPAPVPLAPRFGYGEEDRLI 156 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 530,963 Number of Sequences: 2352 Number of extensions: 10390 Number of successful extensions: 22 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -