BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1556X (384 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 38 0.049 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 34 1.1 UniRef50_Q9FK55 Cluster: Emb|CAB87627.1; n=1; Arabidopsis thalia... 33 2.5 UniRef50_Q4DMM7 Cluster: Putative uncharacterized protein; n=3; ... 31 7.5 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 38.3 bits (85), Expect = 0.049 Identities = 24/57 (42%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = -1 Query: 333 NRYIVPGAYF---SNLCDDVMQCQNIQILNTKCHYLFFLLLIWADELIAHLV*SGYW 172 NR V G F +N ++ C I + FLLL W DEL AHLV SGYW Sbjct: 117 NRPRVAGIAFRLPANRYEEKTVCSQINANPKRFCLSRFLLLRWVDELTAHLVLSGYW 173 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 33.9 bits (74), Expect = 1.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 43 AGWWYLPVRTHKRS 2 A WWYLP RTHKRS Sbjct: 569 AEWWYLPARTHKRS 582 >UniRef50_Q9FK55 Cluster: Emb|CAB87627.1; n=1; Arabidopsis thaliana|Rep: Emb|CAB87627.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 76 Score = 32.7 bits (71), Expect = 2.5 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 123 FYLKVGGAFMLWMSMGSSNHF-IPDELSARPPI*AVKKRDNGIWY*VFV 266 F+ V + W ++ SS F PDEL+ + + KK +NG W VFV Sbjct: 10 FFSAVLAGYFAWKTVSSSPEFDSPDELNEKQELNLKKKMENGFW--VFV 56 >UniRef50_Q4DMM7 Cluster: Putative uncharacterized protein; n=3; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 2798 Score = 31.1 bits (67), Expect = 7.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 115 LRTSISRWVVHLCCGCLWAPVTTLYQMSYQLVRP 216 LR +++ WV+ CGC A TL ++SY ++ P Sbjct: 19 LRAAVTFWVLFSLCGCTLAATRTL-EISYDMLTP 51 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 388,902,360 Number of Sequences: 1657284 Number of extensions: 7195710 Number of successful extensions: 15970 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15967 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 15293670012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -