BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1556X (384 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 22 6.7 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 22 6.7 CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 22 8.9 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 22 8.9 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 22.2 bits (45), Expect = 6.7 Identities = 6/20 (30%), Positives = 11/20 (55%) Frame = +3 Query: 30 YHHPAYFCRVAVMRFGLKRG 89 YH P ++C ++ L+ G Sbjct: 307 YHEPTFWCSISYYELNLRVG 326 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -2 Query: 167 HRHPQHKCTTHLEIEVLRSQY 105 H HP H H + V SQ+ Sbjct: 350 HHHPGHHAALHAHLGVPTSQH 370 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 21.8 bits (44), Expect = 8.9 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 223 AYMGGRADSSSGIKWLLEPIDIHNI 149 AY+G A S GI L PI+ H I Sbjct: 53 AYVGDEAQSKRGILTLKYPIE-HGI 76 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 21.8 bits (44), Expect = 8.9 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -3 Query: 112 LSIVTTAAPRFKPKRITATRQK*AGWWYLPVRTHKR 5 + I+ TA KR T K A WW L + ++ Sbjct: 251 MRILVTACNATMTKRKRYTPNKSAFWWTLEIEALRK 286 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 416,653 Number of Sequences: 2352 Number of extensions: 6959 Number of successful extensions: 46 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -