BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1556X (384 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC032680-1|AAH32680.1| 1425|Homo sapiens zinc finger, FYVE domai... 30 2.9 AL513218-6|CAI12286.1| 1366|Homo sapiens zinc finger, FYVE domai... 30 2.9 AL513218-5|CAI12285.1| 1425|Homo sapiens zinc finger, FYVE domai... 30 2.9 AF130420-1|AAD31695.1| 762|Homo sapiens serine protease-like pr... 30 2.9 AF130419-1|AAD31694.1| 1210|Homo sapiens serine protease-like pr... 30 2.9 AF104304-1|AAC99462.1| 1323|Homo sapiens Smad anchor for recepto... 30 2.9 AB209125-1|BAD92362.1| 1333|Homo sapiens zinc finger, FYVE domai... 30 2.9 AY043095-1|AAK94799.1| 110|Homo sapiens immunoglobulin light ch... 29 6.8 >BC032680-1|AAH32680.1| 1425|Homo sapiens zinc finger, FYVE domain containing 9 protein. Length = 1425 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 164 RHPQHKCTTHLEIEVLRSQYSYNGCPALQTETHYCYTAEIGGVVVPTRAD 15 R P T L ++ + S +GCPA++ + +Y ++ G + R D Sbjct: 254 RDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTD 303 >AL513218-6|CAI12286.1| 1366|Homo sapiens zinc finger, FYVE domain containing 9 protein. Length = 1366 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 164 RHPQHKCTTHLEIEVLRSQYSYNGCPALQTETHYCYTAEIGGVVVPTRAD 15 R P T L ++ + S +GCPA++ + +Y ++ G + R D Sbjct: 254 RDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTD 303 >AL513218-5|CAI12285.1| 1425|Homo sapiens zinc finger, FYVE domain containing 9 protein. Length = 1425 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 164 RHPQHKCTTHLEIEVLRSQYSYNGCPALQTETHYCYTAEIGGVVVPTRAD 15 R P T L ++ + S +GCPA++ + +Y ++ G + R D Sbjct: 254 RDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTD 303 >AF130420-1|AAD31695.1| 762|Homo sapiens serine protease-like protein isoform protein. Length = 762 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 164 RHPQHKCTTHLEIEVLRSQYSYNGCPALQTETHYCYTAEIGGVVVPTRAD 15 R P T L ++ + S +GCPA++ + +Y ++ G + R D Sbjct: 254 RDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTD 303 >AF130419-1|AAD31694.1| 1210|Homo sapiens serine protease-like protein isoform protein. Length = 1210 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 164 RHPQHKCTTHLEIEVLRSQYSYNGCPALQTETHYCYTAEIGGVVVPTRAD 15 R P T L ++ + S +GCPA++ + +Y ++ G + R D Sbjct: 254 RDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTD 303 >AF104304-1|AAC99462.1| 1323|Homo sapiens Smad anchor for receptor activation protein. Length = 1323 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 164 RHPQHKCTTHLEIEVLRSQYSYNGCPALQTETHYCYTAEIGGVVVPTRAD 15 R P T L ++ + S +GCPA++ + +Y ++ G + R D Sbjct: 152 RDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTD 201 >AB209125-1|BAD92362.1| 1333|Homo sapiens zinc finger, FYVE domain containing 9 isoform 3 variant protein. Length = 1333 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -2 Query: 164 RHPQHKCTTHLEIEVLRSQYSYNGCPALQTETHYCYTAEIGGVVVPTRAD 15 R P T L ++ + S +GCPA++ + +Y ++ G + R D Sbjct: 162 RDPSMSAITSLTVDSVISSQGTDGCPAVKKQENYIPDEDLTGKISSPRTD 211 >AY043095-1|AAK94799.1| 110|Homo sapiens immunoglobulin light chain variable region protein. Length = 110 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 74 RFEARGSRCNYTETLELLSQGGWCIYVVDVYGLQ*PLYT 190 RF GS ++T T+ L + +Y YG PL+T Sbjct: 62 RFSGGGSGTHFTLTISRLEPEDFAVYYCQQYGTSPPLFT 100 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,805,241 Number of Sequences: 237096 Number of extensions: 1161220 Number of successful extensions: 5803 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5803 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2583773550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -