BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1555 (716 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F307C3 Cluster: UPI0000F307C3 related cluster; n... 36 1.3 UniRef50_A4VE48 Cluster: Putative uncharacterized protein; n=1; ... 33 9.3 >UniRef50_UPI0000F307C3 Cluster: UPI0000F307C3 related cluster; n=1; Bos taurus|Rep: UPI0000F307C3 UniRef100 entry - Bos Taurus Length = 422 Score = 35.5 bits (78), Expect = 1.3 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -3 Query: 114 LSHTHHRKHN*DFYCLFILKYFHIFVYTHTNIH 16 L+HTHH + + C+++ Y +++VYTH I+ Sbjct: 80 LTHTHHLLYIYIYICMYMCVYIYVYVYTHIYIY 112 >UniRef50_A4VE48 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 307 Score = 32.7 bits (71), Expect = 9.3 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +1 Query: 286 FL*YMNIYKF*VFIHKLNFLCRFSIFIIYVIKSHAHCSLSLL 411 F ++ + KF +F+H+ FLC F F IY ++ +L +L Sbjct: 180 FYFFLLLIKFIIFLHRYIFLCIFLFFCIYYLQDGLQDALKML 221 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,782,161 Number of Sequences: 1657284 Number of extensions: 8431425 Number of successful extensions: 19035 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18907 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57851245060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -