BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1550X (607 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosa... 27 2.1 SPBC18H10.10c |cwc16||complexed with Cdc5 protein Cwf16|Schizosa... 26 3.7 SPBC3B9.10 |vti1||SNARE Vti1|Schizosaccharomyces pombe|chr 2|||M... 25 6.5 SPCC63.02c |aah3||alpha-amylase homolog Aah3|Schizosaccharomyces... 25 8.6 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 25 8.6 >SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosaccharomyces pombe|chr 1|||Manual Length = 639 Score = 27.1 bits (57), Expect = 2.1 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 81 NISSTCPVCVTYEARSKFVITSLRPAFAKIYPSTRPDLA 197 ++ TCP+C+ YE + + SL A + T+P+LA Sbjct: 407 HVLDTCPLCLNYETQPLAPVISLSHR-AYVSLPTQPELA 444 >SPBC18H10.10c |cwc16||complexed with Cdc5 protein Cwf16|Schizosaccharomyces pombe|chr 2|||Manual Length = 294 Score = 26.2 bits (55), Expect = 3.7 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 478 RLNIYDQ*SNSDYTTKIHNFTRQAHNTDDPIIVPT 582 R N + S YTTKI +F+ + H +PI V T Sbjct: 45 RFNAVKKEIGSYYTTKIWSFSLKCHLCSNPIDVHT 79 >SPBC3B9.10 |vti1||SNARE Vti1|Schizosaccharomyces pombe|chr 2|||Manual Length = 214 Score = 25.4 bits (53), Expect = 6.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 273 NQVMKSCRLFPSTAGFLDERGRRFRLLDRVL*MDRFW 163 NQ+ S + T+G LD R + + R L M+RF+ Sbjct: 157 NQLEHSLEMLGDTSGHLDRSLRTLKTMARRLAMNRFF 193 >SPCC63.02c |aah3||alpha-amylase homolog Aah3|Schizosaccharomyces pombe|chr 3|||Manual Length = 564 Score = 25.0 bits (52), Expect = 8.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 6 IIRLESSLFSGYELHTVNPVVLDGANISSTCPVCVTYEARS 128 +I S SG+ L TVN V+ + ++T V +Y + S Sbjct: 481 LIMYPHSKMSGFTLPTVNRTVMPSTSATATTTVYTSYYSPS 521 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 403 FRNIGGFRFEMLFKFV 356 FR IGG RFE L+K V Sbjct: 725 FRGIGGGRFESLYKEV 740 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,343,591 Number of Sequences: 5004 Number of extensions: 44127 Number of successful extensions: 118 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -