BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1550X (607 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.58 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 4.1 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 5.4 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 5.4 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 5.4 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 7.1 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 9.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 25.0 bits (52), Expect = 0.58 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -2 Query: 345 QIRPHSQILSMLEFVFKLANSVLSNQVMKSCRLFPSTAGFL 223 ++ P+S + L +S L S ++PSTAGFL Sbjct: 272 RLNPNSSLQPSLASHHSHLSSALGRSACHSPGVYPSTAGFL 312 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.2 bits (45), Expect = 4.1 Identities = 7/19 (36%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = -2 Query: 567 WIV-SIVCLTCKIMNFCSV 514 WI ++C T I+N C++ Sbjct: 101 WIAFDVMCSTASILNLCAI 119 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.4 Identities = 6/19 (31%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = -2 Query: 567 WIV-SIVCLTCKIMNFCSV 514 W+ ++C T I+N C++ Sbjct: 112 WLTCDVLCCTASILNLCAI 130 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.4 Identities = 6/19 (31%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = -2 Query: 567 WIV-SIVCLTCKIMNFCSV 514 W+ ++C T I+N C++ Sbjct: 112 WLTCDVLCCTASILNLCAI 130 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.4 Identities = 6/19 (31%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = -2 Query: 567 WIV-SIVCLTCKIMNFCSV 514 W+ ++C T I+N C++ Sbjct: 112 WLTCDVLCCTASILNLCAI 130 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 407 WFQEYRWFPVRNAF*IRNL 351 W E+RW + N RNL Sbjct: 378 WICEHRWRQIYNMVRFRNL 396 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 502 SNSDYTTKIHNFTRQAHNTDD 564 S DY + +H +TR T D Sbjct: 246 SKDDYESLVHLYTRDQSETYD 266 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,237 Number of Sequences: 438 Number of extensions: 3247 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -