BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1548 (795 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8ILV0 Cluster: Putative uncharacterized protein; n=9; ... 35 2.7 UniRef50_Q17GD6 Cluster: Tartan; n=2; Aedes aegypti|Rep: Tartan ... 34 3.6 UniRef50_A7RZD5 Cluster: Predicted protein; n=1; Nematostella ve... 34 4.7 UniRef50_Q3E937 Cluster: Uncharacterized protein At5g26190.1; n=... 33 6.2 >UniRef50_Q8ILV0 Cluster: Putative uncharacterized protein; n=9; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 2770 Score = 34.7 bits (76), Expect = 2.7 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = -2 Query: 779 FIFINFIQFIPANLTKRYRQKYYFNKSANQLQM---KIRTFGSGINEIELLDIHDN*KSQ 609 F F+N F P+ + + R+KY +KS L + RT+G G E + + N + Sbjct: 2610 FAFVNNEFFFPSYIINKIRKKYTIDKSVEALILTGAMSRTWGMGFQLFE-CEYNANINDE 2668 Query: 608 YS*YLRIRTYLSQNTRSRDR 549 ++ Y + Y +N SR + Sbjct: 2669 FNLYKKKNKYKKKNVESRKK 2688 >UniRef50_Q17GD6 Cluster: Tartan; n=2; Aedes aegypti|Rep: Tartan - Aedes aegypti (Yellowfever mosquito) Length = 673 Score = 34.3 bits (75), Expect = 3.6 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = -2 Query: 185 SKKSTKVQLTPENHLTDTHENMQTYVRHAKMIDRHYYEYYQGNST 51 SK ST+ TP+ +D +EN+ Y++H + ++ H + Y+Q T Sbjct: 559 SKSSTQPLRTPDPEESDHYENID-YLQHQRALNHHSHPYHQNQHT 602 >UniRef50_A7RZD5 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 915 Score = 33.9 bits (74), Expect = 4.7 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 2/105 (1%) Frame = -2 Query: 767 NFIQFIPANLTKRYRQKYYFNKSANQLQMKIRTFGSGINEIELLDIHDN*KSQYS*YLRI 588 N+I+++P N + + Y FN + N+++ +I SG +ELL + N S L+ Sbjct: 234 NYIEYLPRNFCGMFPKLYDFNANMNKIK-RIPDM-SGCKSMELLKLVHNQISSIGSSLQG 291 Query: 587 RTYLSQNTRSRDRPYALCLNSF*A--SLQ*ICLNRNDIKYILDNS 459 L T +R + N+F SL+ + L +N IK+I N+ Sbjct: 292 MARLKDLTLEGNRITEVNDNTFKGVKSLETLDLAKNQIKHISKNA 336 >UniRef50_Q3E937 Cluster: Uncharacterized protein At5g26190.1; n=1; Arabidopsis thaliana|Rep: Uncharacterized protein At5g26190.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 556 Score = 33.5 bits (73), Expect = 6.2 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 546 VCTMP*FILGLSTVNLPKQKRHQIYFRQFSFFINSK 439 +CT FIL + NLP+ KRH+++ F+ + N K Sbjct: 301 ICTHCDFILHETCANLPRTKRHELHKNHFTLYPNPK 336 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,470,422 Number of Sequences: 1657284 Number of extensions: 12160294 Number of successful extensions: 23357 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23350 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 67908372675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -