BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1548 (795 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70309-7|CAB54292.1| 209|Caenorhabditis elegans Hypothetical pr... 29 5.1 Z98860-2|CAB11545.1| 337|Caenorhabditis elegans Hypothetical pr... 28 8.9 >Z70309-7|CAB54292.1| 209|Caenorhabditis elegans Hypothetical protein R102.8 protein. Length = 209 Score = 28.7 bits (61), Expect = 5.1 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 645 DFINPTAKRSYFHLQLVSRFVEVIFLSIPF 734 +F NP+ R Y H+ L R + ++F+++ + Sbjct: 30 NFFNPSTYRLYIHVLLTMRILLILFITVAY 59 >Z98860-2|CAB11545.1| 337|Caenorhabditis elegans Hypothetical protein Y26G10.2 protein. Length = 337 Score = 27.9 bits (59), Expect = 8.9 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 791 WSTSFIFINFIQFIPANLTK 732 W SF+ +NF F+P+ +T+ Sbjct: 67 WLCSFLLVNFYTFVPSKITR 86 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,013,784 Number of Sequences: 27780 Number of extensions: 314475 Number of successful extensions: 621 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1935274832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -