BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1545 (769 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 23 2.7 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 23 2.7 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 23 3.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 6.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 6.2 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 8.2 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 254 ENCETCKXLEQHVESLQEDFKKHLNA 331 ++C + EQ L+ +F +HLN+ Sbjct: 382 DSCSNIQTGEQFARLLRHNFNRHLNS 407 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 23.0 bits (47), Expect = 2.7 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 254 ENCETCKXLEQHVESLQEDFKKHLNA 331 ++C + EQ L+ +F +HLN+ Sbjct: 389 DSCSNIQTGEQFARLLRHNFNRHLNS 414 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 48 FVNSFYSLVI*KNHL 4 F SFY+LVI K H+ Sbjct: 37 FFGSFYNLVIRKEHI 51 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 722 WQFSNMKSFSSVDTS*TCINASNIYLLFNVAPTL 621 W+ ++ F S+ + TC + L+F V P L Sbjct: 149 WKMPSLSEFLSLFGTETCPAIGSAILIFVVLPEL 182 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 722 WQFSNMKSFSSVDTS*TCINASNIYLLFNVAPTL 621 W+ ++ F S+ + TC + L+F V P L Sbjct: 149 WKMPSLSEFLSLFGTETCPAIGSAILIFVVLPEL 182 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -3 Query: 479 DSSQKSHRFHFHQPHHCIKVQHH 411 +++ + H H HH I QHH Sbjct: 314 NAATNNQNHHHHAGHH-IHAQHH 335 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,212 Number of Sequences: 336 Number of extensions: 3301 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -