BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1545 (769 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC032325-1|AAH32325.1| 195|Homo sapiens TXNDC10 protein protein. 35 0.28 BC107422-1|AAI07423.1| 423|Homo sapiens TXNDC10 protein protein. 34 0.49 BC093794-1|AAH93794.1| 454|Homo sapiens thioredoxin domain cont... 34 0.49 BC093792-1|AAH93792.1| 454|Homo sapiens thioredoxin domain cont... 34 0.49 AB058733-1|BAB47459.1| 486|Homo sapiens KIAA1830 protein protein. 34 0.49 BC056874-1|AAH56874.2| 280|Homo sapiens thioredoxin domain cont... 34 0.64 BC036460-1|AAH36460.1| 280|Homo sapiens thioredoxin domain cont... 34 0.64 AY358640-1|AAQ89003.1| 280|Homo sapiens TXNDC protein. 34 0.64 AK075395-1|BAC11593.1| 280|Homo sapiens protein ( Homo sapiens ... 34 0.64 AB048246-1|BAB20629.1| 280|Homo sapiens thioredoxin-related tra... 34 0.64 U79278-1|AAB50217.1| 421|Homo sapiens protein disulfide isomera... 31 4.5 D49489-1|BAA08450.1| 440|Homo sapiens human P5 protein. 31 4.5 BC001312-1|AAH01312.1| 440|Homo sapiens protein disulfide isome... 31 4.5 AY358646-1|AAQ89009.1| 432|Homo sapiens disulfide isomerase pro... 31 4.5 AY326464-1|AAR99514.1| 363|Homo sapiens putative protein STRF8 ... 31 4.5 AL133541-2|CAI19473.1| 432|Homo sapiens thioredoxin domain cont... 31 4.5 AK127433-1|BAC86977.1| 492|Homo sapiens protein ( Homo sapiens ... 31 4.5 AK075291-1|BAC11526.1| 432|Homo sapiens protein ( Homo sapiens ... 31 4.5 AJ440721-1|CAD29430.1| 363|Homo sapiens thioredoxin related pro... 31 4.5 AC092687-3|AAY24070.1| 440|Homo sapiens unknown protein. 31 4.5 X07077-1|CAA30112.1| 216|Homo sapiens glutathione-insulin trans... 31 6.0 X05130-1|CAA28775.1| 508|Homo sapiens protein ( Human mRNA for ... 31 6.0 M22806-1|AAC13652.1| 508|Homo sapiens prolyl 4-hydroxylase beta... 31 6.0 J02783-1|AAA61169.1| 508|Homo sapiens P4HB protein. 31 6.0 BC071892-1|AAH71892.1| 508|Homo sapiens procollagen-proline, 2-... 31 6.0 BC029617-1|AAH29617.1| 508|Homo sapiens procollagen-proline, 2-... 31 6.0 BC014504-1|AAH14504.1| 185|Homo sapiens P4HB protein protein. 31 6.0 BC010859-1|AAH10859.1| 508|Homo sapiens procollagen-proline, 2-... 31 6.0 >BC032325-1|AAH32325.1| 195|Homo sapiens TXNDC10 protein protein. Length = 195 Score = 35.1 bits (77), Expect = 0.28 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLKS 645 W V FY C C++L ++W VG +KS Sbjct: 44 WLVDFYAPWCGHCKKLESIWNEVGLEMKS 72 >BC107422-1|AAI07423.1| 423|Homo sapiens TXNDC10 protein protein. Length = 423 Score = 34.3 bits (75), Expect = 0.49 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLKS 645 W V FY C C++L +W VG +KS Sbjct: 44 WLVDFYAPWCGHCKKLEPIWNEVGLEMKS 72 >BC093794-1|AAH93794.1| 454|Homo sapiens thioredoxin domain containing 10 protein. Length = 454 Score = 34.3 bits (75), Expect = 0.49 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLKS 645 W V FY C C++L +W VG +KS Sbjct: 44 WLVDFYAPWCGHCKKLEPIWNEVGLEMKS 72 >BC093792-1|AAH93792.1| 454|Homo sapiens thioredoxin domain containing 10 protein. Length = 454 Score = 34.3 bits (75), Expect = 0.49 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLKS 645 W V FY C C++L +W VG +KS Sbjct: 44 WLVDFYAPWCGHCKKLEPIWNEVGLEMKS 72 >AB058733-1|BAB47459.1| 486|Homo sapiens KIAA1830 protein protein. Length = 486 Score = 34.3 bits (75), Expect = 0.49 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLKS 645 W V FY C C++L +W VG +KS Sbjct: 76 WLVDFYAPWCGHCKKLEPIWNEVGLEMKS 104 >BC056874-1|AAH56874.2| 280|Homo sapiens thioredoxin domain containing 1 protein. Length = 280 Score = 33.9 bits (74), Expect = 0.64 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 553 GDWFVMFYGAACVECQRLHAVWES 624 GDW + FY C CQ L WES Sbjct: 45 GDWMIEFYAPWCPACQNLQPEWES 68 >BC036460-1|AAH36460.1| 280|Homo sapiens thioredoxin domain containing 1 protein. Length = 280 Score = 33.9 bits (74), Expect = 0.64 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 553 GDWFVMFYGAACVECQRLHAVWES 624 GDW + FY C CQ L WES Sbjct: 45 GDWMIEFYAPWCPACQNLQPEWES 68 >AY358640-1|AAQ89003.1| 280|Homo sapiens TXNDC protein. Length = 280 Score = 33.9 bits (74), Expect = 0.64 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 553 GDWFVMFYGAACVECQRLHAVWES 624 GDW + FY C CQ L WES Sbjct: 45 GDWMIEFYAPWCPACQNLQPEWES 68 >AK075395-1|BAC11593.1| 280|Homo sapiens protein ( Homo sapiens cDNA PSEC0085 fis, clone NT2RP2006476, highly similar to Thioredoxin domain containing protein. ). Length = 280 Score = 33.9 bits (74), Expect = 0.64 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 553 GDWFVMFYGAACVECQRLHAVWES 624 GDW + FY C CQ L WES Sbjct: 45 GDWMIEFYAPWCPACQNLQPEWES 68 >AB048246-1|BAB20629.1| 280|Homo sapiens thioredoxin-related transmembrane protein protein. Length = 280 Score = 33.9 bits (74), Expect = 0.64 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 553 GDWFVMFYGAACVECQRLHAVWES 624 GDW + FY C CQ L WES Sbjct: 45 GDWMIEFYAPWCPACQNLQPEWES 68 >U79278-1|AAB50217.1| 421|Homo sapiens protein disulfide isomerase-related protein 5 protein. Length = 421 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLK 642 W V FY C CQRL W+ LK Sbjct: 27 WLVEFYAPWCGHCQRLTPEWKKAATALK 54 >D49489-1|BAA08450.1| 440|Homo sapiens human P5 protein. Length = 440 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLK 642 W V FY C CQRL W+ LK Sbjct: 46 WLVEFYAPWCGHCQRLTPEWKKAATALK 73 >BC001312-1|AAH01312.1| 440|Homo sapiens protein disulfide isomerase family A, member 6 protein. Length = 440 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLK 642 W V FY C CQRL W+ LK Sbjct: 46 WLVEFYAPWCGHCQRLTPEWKKAATALK 73 >AY358646-1|AAQ89009.1| 432|Homo sapiens disulfide isomerase protein. Length = 432 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 541 GATTGDWFVMFYGAACVECQRLHAVWESVG 630 G + FVMF+ C CQRL W +G Sbjct: 74 GIQSAAHFVMFFAPWCGHCQRLQPTWNDLG 103 >AY326464-1|AAR99514.1| 363|Homo sapiens putative protein STRF8 protein. Length = 363 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 541 GATTGDWFVMFYGAACVECQRLHAVWESVG 630 G + FVMF+ C CQRL W +G Sbjct: 5 GIQSAAHFVMFFAPWCGHCQRLQPTWNDLG 34 >AL133541-2|CAI19473.1| 432|Homo sapiens thioredoxin domain containing 5 protein. Length = 432 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 541 GATTGDWFVMFYGAACVECQRLHAVWESVG 630 G + FVMF+ C CQRL W +G Sbjct: 74 GIQSAAHFVMFFAPWCGHCQRLQPTWNDLG 103 >AK127433-1|BAC86977.1| 492|Homo sapiens protein ( Homo sapiens cDNA FLJ45525 fis, clone BRTHA2026311, highly similar to Protein disulfide isomerase A6 precursor (EC 5.3.4.1). ). Length = 492 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLK 642 W V FY C CQRL W+ LK Sbjct: 98 WLVEFYAPWCGHCQRLTPEWKKAATALK 125 >AK075291-1|BAC11526.1| 432|Homo sapiens protein ( Homo sapiens cDNA FLJ90810 fis, clone Y79AA1000876, weakly similar to PROTEIN DISULFIDE ISOMERASE-RELATED PROTEIN PRECURSOR. ). Length = 432 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 541 GATTGDWFVMFYGAACVECQRLHAVWESVG 630 G + FVMF+ C CQRL W +G Sbjct: 74 GIQSAAHFVMFFAPWCGHCQRLQPTWNDLG 103 >AJ440721-1|CAD29430.1| 363|Homo sapiens thioredoxin related protein protein. Length = 363 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 541 GATTGDWFVMFYGAACVECQRLHAVWESVG 630 G + FVMF+ C CQRL W +G Sbjct: 5 GIQSAAHFVMFFAPWCGHCQRLQPTWNDLG 34 >AC092687-3|AAY24070.1| 440|Homo sapiens unknown protein. Length = 440 Score = 31.1 bits (67), Expect = 4.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 559 WFVMFYGAACVECQRLHAVWESVGATLK 642 W V FY C CQRL W+ LK Sbjct: 46 WLVEFYAPWCGHCQRLTPEWKKAATALK 73 >X07077-1|CAA30112.1| 216|Homo sapiens glutathione-insulin transhydrogenase (216 AA) protein. Length = 216 Score = 30.7 bits (66), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 562 FVMFYGAACVECQRLHAVWESVGATLK 642 FV FY C C++L +W+ +G T K Sbjct: 97 FVEFYAPWCGHCKQLAPIWDKLGETYK 123 >X05130-1|CAA28775.1| 508|Homo sapiens protein ( Human mRNA for prolyl 4-hydoxylase beta subunit (EC 1.14.11.2) (procollagen-L-proline, 2-oxoglutarate:oxygen oxidoreductase, 4-hydroxylating). ). Length = 508 Score = 30.7 bits (66), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 562 FVMFYGAACVECQRLHAVWESVGATLK 642 FV FY C C++L +W+ +G T K Sbjct: 389 FVEFYAPWCGHCKQLAPIWDKLGETYK 415 >M22806-1|AAC13652.1| 508|Homo sapiens prolyl 4-hydroxylase beta-subunit protein. Length = 508 Score = 30.7 bits (66), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 562 FVMFYGAACVECQRLHAVWESVGATLK 642 FV FY C C++L +W+ +G T K Sbjct: 389 FVEFYAPWCGHCKQLAPIWDKLGETYK 415 >J02783-1|AAA61169.1| 508|Homo sapiens P4HB protein. Length = 508 Score = 30.7 bits (66), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 562 FVMFYGAACVECQRLHAVWESVGATLK 642 FV FY C C++L +W+ +G T K Sbjct: 389 FVEFYAPWCGHCKQLAPIWDKLGETYK 415 >BC071892-1|AAH71892.1| 508|Homo sapiens procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta protein. Length = 508 Score = 30.7 bits (66), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 562 FVMFYGAACVECQRLHAVWESVGATLK 642 FV FY C C++L +W+ +G T K Sbjct: 389 FVEFYAPWCGHCKQLAPIWDKLGETYK 415 >BC029617-1|AAH29617.1| 508|Homo sapiens procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta protein. Length = 508 Score = 30.7 bits (66), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 562 FVMFYGAACVECQRLHAVWESVGATLK 642 FV FY C C++L +W+ +G T K Sbjct: 389 FVEFYAPWCGHCKQLAPIWDKLGETYK 415 >BC014504-1|AAH14504.1| 185|Homo sapiens P4HB protein protein. Length = 185 Score = 30.7 bits (66), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 562 FVMFYGAACVECQRLHAVWESVGATLK 642 FV FY C C++L +W+ +G T K Sbjct: 66 FVEFYAPWCGHCKQLAPIWDKLGETYK 92 >BC010859-1|AAH10859.1| 508|Homo sapiens procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta protein. Length = 508 Score = 30.7 bits (66), Expect = 6.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 562 FVMFYGAACVECQRLHAVWESVGATLK 642 FV FY C C++L +W+ +G T K Sbjct: 389 FVEFYAPWCGHCKQLAPIWDKLGETYK 415 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,012,196 Number of Sequences: 237096 Number of extensions: 1758205 Number of successful extensions: 3684 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 3402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3663 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9255747988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -