BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1543 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 26 0.38 DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 23 2.7 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 23 2.7 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 25.8 bits (54), Expect = 0.38 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 237 VLQRDRAGKHVPRAVFVDLEPTVVDEVRTGTYRQL 341 VL+ RA H+ + D+EPTV RQL Sbjct: 233 VLEERRAQSHLEAHCYFDIEPTVQQHQPVTVNRQL 267 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -3 Query: 175 GFHARGSTAPSRRCQSVRRLDRCERRCIPSFCKKI 71 GF G +C S RC+ RC FC + Sbjct: 24 GFGGFGGLGGRGKCPSNEIFSRCDGRC-QRFCPNV 57 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 23.0 bits (47), Expect = 2.7 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -3 Query: 175 GFHARGSTAPSRRCQSVRRLDRCERRCIPSFCKKI 71 GF G +C S RC+ RC FC + Sbjct: 24 GFGGFGGLGGRGKCPSNEIFSRCDGRC-QRFCPNV 57 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,693 Number of Sequences: 438 Number of extensions: 4815 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -