BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1540 (838 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 3.0 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 23 3.0 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 5.2 AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esteras... 22 5.2 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 6.9 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 108 DLPGVNAYSDTHRLSINGHGLGQIHHVQSQKRN 10 D+ VN + L+ H L Q H+Q +N Sbjct: 457 DIDDVNFQEENLALTSTEHSLSQSQHIQKIPKN 489 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 108 DLPGVNAYSDTHRLSINGHGLGQIHHVQSQKRN 10 D+ VN + L+ H L Q H+Q +N Sbjct: 282 DIDDVNFQEENLALTSTEHSLSQSQHIQKIPKN 314 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -3 Query: 251 SSRMR*LYVSSLTLMVPGTPVVSQRLVRF 165 S R L++ L ++ PG PV+++ L F Sbjct: 570 SDRRLELFLELLPMLAPGAPVMTRYLGDF 598 >AJ850294-1|CAH64514.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.2 bits (45), Expect = 5.2 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 79 ITIGIHSGEVVTGVIGHRMPRYCLFGNT--VNLTSRCETTGVPGT 207 + + IHSG +TG P Y + N VNL R G T Sbjct: 114 VVVYIHSGAFMTGYGSFYQPDYFIDKNIVFVNLNYRLGPLGFLST 158 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 625 KRFFYNKIICSCTIF 581 K+ FY+KII S +IF Sbjct: 229 KKVFYSKIIISGSIF 243 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,404 Number of Sequences: 336 Number of extensions: 3638 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -