BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1538 (719 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 31 0.047 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 25 1.8 AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 24 5.4 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 9.5 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 30.7 bits (66), Expect = 0.047 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 243 RAYSQEVLPPVNLLLKGGSSFGARRGSHSQI*MRSFPSVCHY 118 +A+ + V P NLL G GA G H I +P++ H+ Sbjct: 519 KAFLRNVPPNYNLLNYGSGGGGAEMGCHRDIDPEEYPTLLHF 560 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 711 ASGRQRLGSAPGITDVHGRR*P 646 A+GR R G PG + H RR P Sbjct: 317 AAGRLRTGPVPGAAERHRRRRP 338 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 432 LFFVVVKRLILCFIFMYII*DAVCMIC 512 L ++ + I CFI++Y+I D + C Sbjct: 259 LHYLHLSTSIWCFIYIYVIYDLIANEC 285 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +1 Query: 637 DGEWLPSPMDISNARGRAKP 696 DGEW P +D +G KP Sbjct: 255 DGEWEPPMIDNPEYKGEWKP 274 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 642,455 Number of Sequences: 2352 Number of extensions: 10403 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -