BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1535X (602 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 27 0.62 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 1.4 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 1.4 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 5.8 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 5.8 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 26.6 bits (56), Expect = 0.62 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 404 HGPAEGIDERTAKNRFTSEEKRALDRLHKDIYQEIDMLLKPTG 532 H AEG+ E +E R L K + +D+L KP G Sbjct: 442 HKDAEGVTESAEDCYDKEKEHRIPYSLPKSTFDRLDLLKKPNG 484 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 315 DLLRSRPSHLLYQ*RNYFLMXTFLRVKLWTMVLLRVLMRE 434 DLLR PS +++ M F +K W M LR++ R+ Sbjct: 345 DLLRKEPSFSAEWAKSFNKMSHFNSLKQWGMNRLRMMNRD 384 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 25.4 bits (53), Expect = 1.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 315 DLLRSRPSHLLYQ*RNYFLMXTFLRVKLWTMVLLRVLMRE 434 DLLR PS +++ M F +K W M LR++ R+ Sbjct: 346 DLLRKEPSFSAEWAKSFNKMSHFNSLKQWGMNRLRMMNRD 385 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 5.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 437 QFSHQYPQQDHGP*FDPQESXHQE 366 Q+ + PQ+ H PQ+ HQ+ Sbjct: 4 QYQYAQPQRQHPSLVGPQQQQHQQ 27 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 5.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 437 QFSHQYPQQDHGP*FDPQESXHQE 366 Q+ + PQ+ H PQ+ HQ+ Sbjct: 4 QYQYAQPQRQHPSLVGPQQQQHQQ 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 430,845 Number of Sequences: 2352 Number of extensions: 6906 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -