BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1535X (602 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29607-1|AAA82930.1| 478|Homo sapiens methionine aminopeptidase... 61 3e-09 U13261-1|AAC63402.1| 478|Homo sapiens eIF-2-associated p67 homo... 61 3e-09 BC013782-1|AAH13782.1| 478|Homo sapiens methionyl aminopeptidas... 61 3e-09 AK091730-1|BAC03733.1| 455|Homo sapiens protein ( Homo sapiens ... 61 3e-09 >U29607-1|AAA82930.1| 478|Homo sapiens methionine aminopeptidase protein. Length = 478 Score = 61.3 bits (142), Expect = 3e-09 Identities = 27/59 (45%), Positives = 43/59 (72%) Frame = +2 Query: 329 QTVPPTIPVAELFPDGXFPEGQIMDHGPAEGIDERTAKNRFTSEEKRALDRLHKDIYQE 505 QT PP++P+ +L+P+G FP+GQ ++ P + D RTA R TSEEK+ALD+ ++I+ + Sbjct: 112 QTDPPSVPICDLYPNGVFPKGQECEYPPTQ--DGRTAAWRTTSEEKKALDQASEEIWND 168 Score = 56.4 bits (130), Expect = 7e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 508 RHAAEAHRQTRKHIRNWLKPGMTMIDICEEL 600 R AAEAHRQ RK++ +W+KPGMTMI+ICE+L Sbjct: 170 REAAEAHRQVRKYVMSWIKPGMTMIEICEKL 200 >U13261-1|AAC63402.1| 478|Homo sapiens eIF-2-associated p67 homolog protein. Length = 478 Score = 61.3 bits (142), Expect = 3e-09 Identities = 27/59 (45%), Positives = 43/59 (72%) Frame = +2 Query: 329 QTVPPTIPVAELFPDGXFPEGQIMDHGPAEGIDERTAKNRFTSEEKRALDRLHKDIYQE 505 QT PP++P+ +L+P+G FP+GQ ++ P + D RTA R TSEEK+ALD+ ++I+ + Sbjct: 112 QTDPPSVPICDLYPNGVFPKGQECEYPPTQ--DGRTAAWRTTSEEKKALDQASEEIWND 168 Score = 56.4 bits (130), Expect = 7e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 508 RHAAEAHRQTRKHIRNWLKPGMTMIDICEEL 600 R AAEAHRQ RK++ +W+KPGMTMI+ICE+L Sbjct: 170 REAAEAHRQVRKYVMSWIKPGMTMIEICEKL 200 >BC013782-1|AAH13782.1| 478|Homo sapiens methionyl aminopeptidase 2 protein. Length = 478 Score = 61.3 bits (142), Expect = 3e-09 Identities = 27/59 (45%), Positives = 43/59 (72%) Frame = +2 Query: 329 QTVPPTIPVAELFPDGXFPEGQIMDHGPAEGIDERTAKNRFTSEEKRALDRLHKDIYQE 505 QT PP++P+ +L+P+G FP+GQ ++ P + D RTA R TSEEK+ALD+ ++I+ + Sbjct: 112 QTDPPSVPICDLYPNGVFPKGQECEYPPTQ--DGRTAAWRTTSEEKKALDQASEEIWND 168 Score = 56.4 bits (130), Expect = 7e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 508 RHAAEAHRQTRKHIRNWLKPGMTMIDICEEL 600 R AAEAHRQ RK++ +W+KPGMTMI+ICE+L Sbjct: 170 REAAEAHRQVRKYVMSWIKPGMTMIEICEKL 200 >AK091730-1|BAC03733.1| 455|Homo sapiens protein ( Homo sapiens cDNA FLJ34411 fis, clone HEART2002220, highly similar to METHIONINE AMINOPEPTIDASE 2 (EC 3.4.11.18). ). Length = 455 Score = 61.3 bits (142), Expect = 3e-09 Identities = 27/59 (45%), Positives = 43/59 (72%) Frame = +2 Query: 329 QTVPPTIPVAELFPDGXFPEGQIMDHGPAEGIDERTAKNRFTSEEKRALDRLHKDIYQE 505 QT PP++P+ +L+P+G FP+GQ ++ P + D RTA R TSEEK+ALD+ ++I+ + Sbjct: 89 QTDPPSVPICDLYPNGVFPKGQECEYPPTQ--DGRTAAWRTTSEEKKALDQASEEIWND 145 Score = 56.4 bits (130), Expect = 7e-08 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 508 RHAAEAHRQTRKHIRNWLKPGMTMIDICEEL 600 R AAEAHRQ RK++ +W+KPGMTMI+ICE+L Sbjct: 147 REAAEAHRQVRKYVMSWIKPGMTMIEICEKL 177 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,101,667 Number of Sequences: 237096 Number of extensions: 984864 Number of successful extensions: 2552 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2548 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6354183230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -