BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1532 (781 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY052088-1|AAK93512.1| 491|Drosophila melanogaster SD03973p pro... 30 4.1 AE013599-2016|AAF58166.1| 491|Drosophila melanogaster CG11807-P... 30 4.1 >AY052088-1|AAK93512.1| 491|Drosophila melanogaster SD03973p protein. Length = 491 Score = 29.9 bits (64), Expect = 4.1 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = +1 Query: 220 GRVLWLK----RHFSNLQERVIKSLKFEKNILTKKKLV 321 G+V WL R F+NL E+++ + K +L KKLV Sbjct: 37 GKVEWLVERRYRDFANLHEKLVGEISISKKLLPPKKLV 74 >AE013599-2016|AAF58166.1| 491|Drosophila melanogaster CG11807-PA protein. Length = 491 Score = 29.9 bits (64), Expect = 4.1 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = +1 Query: 220 GRVLWLK----RHFSNLQERVIKSLKFEKNILTKKKLV 321 G+V WL R F+NL E+++ + K +L KKLV Sbjct: 37 GKVEWLVERRYRDFANLHEKLVGEISISKKLLPPKKLV 74 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,083,670 Number of Sequences: 53049 Number of extensions: 609665 Number of successful extensions: 969 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3623012976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -