BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1530 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 25 3.3 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 4.3 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 7.6 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 24.6 bits (51), Expect = 3.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 220 FGELLGSCNGFGYLVERLGTAFAPVKFDMQ 309 FG +C G G LV ++G F KF+ Q Sbjct: 431 FGAGPRNCIGQGVLVSKIGLVFLLSKFNFQ 460 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 598 DILQMNINNCCVTQ 557 DILQ+NIN C + Q Sbjct: 2 DILQININKCRIAQ 15 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.4 bits (48), Expect = 7.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 640 HQLPKDLIICAKVGDILQMNIN 575 HQLP+DL+ K +LQ+ N Sbjct: 365 HQLPEDLLRDQKALQVLQLQHN 386 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 697,411 Number of Sequences: 2352 Number of extensions: 13881 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -