BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1530 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.7 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 23 3.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.3 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 5.3 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 213 FPFTTGGKDFTSSKQTIVCCVELAIV 136 FP T G++ +QTI CV A+V Sbjct: 201 FPATPTGREVALIEQTIGTCVANAVV 226 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -2 Query: 133 YLLAVILNILFTRIL*LQLIYYTFTK 56 Y++ VIL +LF ++ L I++ T+ Sbjct: 315 YMVTVILGLLFHALITLPTIFWFLTR 340 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 571 CCVTQL*YFFTEPSYAL-VNTYSYLSPFLPVNFLVY 467 CC ++ + T P+ + V T++ + F+PV +L Y Sbjct: 488 CCWWKICWTITTPAICVGVFTFNIIK-FVPVKYLTY 522 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 571 CCVTQL*YFFTEPSYAL-VNTYSYLSPFLPVNFLVY 467 CC ++ + T P+ + V T++ + F+PV +L Y Sbjct: 541 CCWWKICWTITTPAICVGVFTFNIIK-FVPVKYLTY 575 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,210 Number of Sequences: 438 Number of extensions: 3707 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -