BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1524 (659 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0290 + 3843610-3843712,3844088-3846003 37 0.012 04_01_0283 + 3768732-3768792,3769235-3769876,3769907-3770076,377... 34 0.087 03_05_1124 + 30559633-30559674,30559781-30559890,30559973-305600... 32 0.47 08_01_0033 + 244930-245105,245297-245344,245835-246539,246652-24... 30 1.9 04_01_0301 + 4016588-4016627,4016715-4018837 29 2.5 01_06_0124 - 26692731-26697046,26698749-26698827,26698899-266989... 29 2.5 04_01_0256 + 3402982-3402984,3403077-3403158,3403307-3403449,340... 29 3.3 09_03_0214 - 13517895-13518012,13519008-13519052,13519611-135196... 28 5.7 07_03_1577 - 27869596-27869682,27869769-27869869,27869956-278699... 28 5.7 01_06_1261 - 35826513-35828941,35829201-35829294 28 5.7 12_02_0953 - 24736642-24736673,24737104-24737188,24737267-247373... 28 7.6 07_03_1424 - 26474464-26474514,26474549-26474635,26474905-264750... 28 7.6 06_01_0799 - 5964410-5964565,5964709-5964750,5968762-5968803,596... 28 7.6 05_07_0167 + 28115290-28115349,28115952-28115996,28116087-281161... 28 7.6 03_05_0754 + 27452203-27452242,27452360-27455611,27456480-274565... 28 7.6 03_05_0259 + 22444269-22444297,22444818-22445536,22445588-224459... 28 7.6 02_03_0273 + 17173983-17174339,17174423-17174575,17174638-171747... 28 7.6 >04_01_0290 + 3843610-3843712,3844088-3846003 Length = 672 Score = 37.1 bits (82), Expect = 0.012 Identities = 16/43 (37%), Positives = 30/43 (69%) Frame = +1 Query: 280 EEKARLISQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQ 408 +EKA+++ + ++L++ L+++ +D +K EN KLRSE V Q Sbjct: 146 DEKAKMMMESVDLKSRLEEIQGNMDMIKSENDKLRSEALVAEQ 188 >04_01_0283 + 3768732-3768792,3769235-3769876,3769907-3770076, 3770134-3770511,3770602-3770991 Length = 546 Score = 34.3 bits (75), Expect = 0.087 Identities = 13/43 (30%), Positives = 30/43 (69%) Frame = +1 Query: 280 EEKARLISQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQ 408 +EKA+++ + ++L++ ++++ +D ++ EN KLRSE + Q Sbjct: 130 DEKAKMMMESVDLKSRIEEIQGNMDMIESENDKLRSEALIAEQ 172 >03_05_1124 + 30559633-30559674,30559781-30559890,30559973-30560030, 30560455-30560718,30560803-30560940,30561264-30561315, 30561525-30561604,30561929-30561988,30562084-30562164, 30562299-30562376,30563548-30563676,30563896-30564039, 30564145-30564290,30564402-30564558,30564657-30564715, 30564800-30564959,30565054-30565203,30565309-30565445, 30565531-30565677,30565995-30566052,30566417-30566518, 30566590-30566627,30566846-30566972,30567053-30567223, 30567313-30567444,30567575-30567681,30567815-30567875, 30567970-30568147,30568245-30568450,30568781-30568879, 30569021-30569236,30569333-30569472,30569559-30569660, 30569747-30569861,30570129-30570194,30570323-30570480, 30570594-30570690,30570931-30571137,30571435-30571505, 30571648-30571747,30571836-30571892,30571969-30572025, 30572108-30572188,30572319-30572401,30572504-30572651 Length = 1722 Score = 31.9 bits (69), Expect = 0.47 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 268 IDEQEEKARLISQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQ 408 ++ Q+E L ++LE + L+ L + ++ ++ L SENQVL Q Sbjct: 1247 LEVQKESDELSREILEKDSKLNQLQEMIERLETNLSSLESENQVLRQ 1293 >08_01_0033 + 244930-245105,245297-245344,245835-246539,246652-246796, 246893-247240,247882-248721,248786-248832,249470-249596, 249672-249836,249973-251370,251453-251713,251802-252161 Length = 1539 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/69 (33%), Positives = 30/69 (43%), Gaps = 5/69 (7%) Frame = +2 Query: 92 CGDDNIPLADDDPQVIISDDTDNNRLDHGRSMDS-----LPSSYTAGSSSPGLNGPASFD 256 C D P DD P + + T N D +S+ S PSS T SSS G + +D Sbjct: 544 CASD-FPSRDDSPALRLYHATSNGYTDVKKSLSSSTKVDAPSSITNSSSSVGEDASIRYD 602 Query: 257 LIPA*MSKR 283 P S+R Sbjct: 603 SKPPLHSQR 611 >04_01_0301 + 4016588-4016627,4016715-4018837 Length = 720 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +1 Query: 280 EEKARLISQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQ 408 +EK +++ + +L+ L+++ D V+ EN +LRSE + Q Sbjct: 255 DEKDKMMMESADLKRRLEEIQANKDLVESENDRLRSEALITKQ 297 >01_06_0124 - 26692731-26697046,26698749-26698827,26698899-26698955, 26699321-26699416 Length = 1515 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Frame = +1 Query: 268 IDEQEEKARLISQVLE----LQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSAS 435 + E EK +S LE + + L ++ +K ENL L EN L +NL + Sbjct: 308 LQETNEKCTFLSSQLEKAQLAEKEVQTLLSEIEKIKNENLMLSRENDNLKACEQNLGTEC 367 Query: 436 SVFQST 453 S ++T Sbjct: 368 SQLKAT 373 >04_01_0256 + 3402982-3402984,3403077-3403158,3403307-3403449, 3403557-3403832,3404136-3404315 Length = 227 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/49 (28%), Positives = 29/49 (59%) Frame = +1 Query: 277 QEEKARLISQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENL 423 Q +K + L+ ++L+ +VD+ ++EN +L EN+ L + I++L Sbjct: 115 QADKTAAEEEQKRLKRDKENLNLKVDTKRKENRRLEEENKKLQRKIKDL 163 >09_03_0214 - 13517895-13518012,13519008-13519052,13519611-13519687, 13520536-13520668,13522210-13522322 Length = 161 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -3 Query: 501 MKIIWLNNSLLLYIGSSGLK 442 +K I +NNSLLLY GSS ++ Sbjct: 89 LKRITINNSLLLYAGSSAIR 108 >07_03_1577 - 27869596-27869682,27869769-27869869,27869956-27869995, 27870879-27870953 Length = 100 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +1 Query: 301 SQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSA 432 S V +LQ+ LD ++ + KE+N KL EN+ L I +L+ A Sbjct: 50 SAVKDLQSKLDAVNTECLAEKEKNKKLIIENEKLQYRITHLIRA 93 >01_06_1261 - 35826513-35828941,35829201-35829294 Length = 840 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/49 (22%), Positives = 27/49 (55%) Frame = +1 Query: 301 SQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSASSVFQ 447 +Q+ ++N D+L +R+DS+++E L ++ L + ++ + Q Sbjct: 350 AQINRMKNEADELQKRLDSLEDEKAALIEDSSKLSERLKQVEEVLQTIQ 398 >12_02_0953 - 24736642-24736673,24737104-24737188,24737267-24737386, 24737484-24737549,24737629-24737799,24737901-24737999, 24738075-24738186,24738282-24738343,24738412-24738483, 24738583-24738681,24738764-24738997,24739104-24739178, 24739299-24739386,24739478-24739638,24739734-24739841, 24739934-24741922,24742007-24742279,24742957-24743295, 24743449-24745038,24745166-24745241,24745333-24745412, 24745614-24745679,24745761-24745830,24745899-24746134, 24746149-24746319,24746915-24747097,24747176-24747241, 24747326-24747389,24747472-24747530,24747612-24747699, 24747799-24747891,24747956-24748116,24748215-24748307, 24748405-24748518,24748654-24748773,24748852-24748935, 24749016-24749171,24749518-24750154,24752874-24752929 Length = 2815 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/43 (30%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 271 DEQEEKARLISQVLE-LQNTLDDLSQRVDSVKEENLKLRSENQ 396 +E++E+ +L+ + +E L+ T+ L +VD +KEE + R + Sbjct: 2298 EEKDEEVKLLERSIEELETTVCALENKVDIIKEEAERQRMHRE 2340 >07_03_1424 - 26474464-26474514,26474549-26474635,26474905-26475006, 26475149-26475260,26475405-26475463,26475559-26475633, 26475734-26475832,26476128-26476343,26476426-26476500, 26476583-26476670,26476757-26476902,26477240-26477347, 26477417-26478436,26478437-26478715,26479471-26480520, 26480636-26480692,26480780-26480837,26481379-26481458, 26481598-26481654,26481764-26481833,26481967-26482202, 26482341-26482445,26482534-26482680,26482758-26482823, 26482916-26482979,26484040-26484200,26484308-26484400, 26484487-26484600,26484684-26484803,26484893-26484976, 26485061-26485216,26485389-26485811 Length = 1885 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +1 Query: 283 EKARLISQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSAS 435 E+ RL+SQ+ EL + L +S +++EE LKL + ++ E +AS Sbjct: 1425 EEGRLMSQIKELNDNLKIISIDKGNLEEEILKLTDKLEMAVALAEENEAAS 1475 >06_01_0799 - 5964410-5964565,5964709-5964750,5968762-5968803, 5968903-5968998,5970549-5970630,5973820-5974001 Length = 199 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 4/52 (7%) Frame = +2 Query: 98 DDNIPLADDDPQV----IISDDTDNNRLDHGRSMDSLPSSYTAGSSSPGLNG 241 ++N+ L D PQV + DT+N + G+S +S+ ++ +GSS +G Sbjct: 140 EENMRLRDQMPQVPTAGLAVPDTENVLTEDGQSSESVMTALNSGSSQDNDDG 191 >05_07_0167 + 28115290-28115349,28115952-28115996,28116087-28116179, 28116259-28116342,28116949-28117131,28117234-28117276, 28117671-28117891,28118060-28118137,28118404-28118529, 28118616-28118825 Length = 380 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 Query: 310 LELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSASS 438 L Q +DL+ +V+S+ EN LRSE L + E L +S Sbjct: 266 LRKQAETEDLATQVESLTAENTSLRSEISRLSESSEKLRLENS 308 >03_05_0754 + 27452203-27452242,27452360-27455611,27456480-27456533, 27456774-27456872,27456948-27457012,27457476-27457575, 27458326-27458408,27458494-27458569,27458920-27459698 Length = 1515 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 277 QEEKARLISQVLELQNTLDDLSQRVDSVKEENL 375 +EEK +L S + E +D+L Q + ++EENL Sbjct: 797 REEKDKLCSIIDERCRNIDELQQHIAVLEEENL 829 >03_05_0259 + 22444269-22444297,22444818-22445536,22445588-22445937, 22449455-22449757 Length = 466 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/53 (26%), Positives = 29/53 (54%) Frame = +1 Query: 280 EEKARLISQVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIENLMSASS 438 E +A ++ L + N + + V ++EE +LR + +LG+ ++ +ASS Sbjct: 57 ETQAAIVKLDLGMNNWRPQVEEAVQELREEVGELRQQVDLLGKAVQTSTAASS 109 >02_03_0273 + 17173983-17174339,17174423-17174575,17174638-17174700, 17174943-17175026,17175120-17175242,17175466-17175519, 17175669-17175764,17176163-17176258,17177179-17177324, 17178503-17178632,17178697-17179272,17179364-17179462, 17179535-17179687,17179794-17180558,17181384-17181683 Length = 1064 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 304 QVLELQNTLDDLSQRVDSVKEENLKLRSENQVLGQYIEN 420 ++ L+ +D + + + ENL L+ EN++L Q EN Sbjct: 680 KIARLETLVDGILPTEELMHAENLSLQDENKILHQKYEN 718 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,840,552 Number of Sequences: 37544 Number of extensions: 272879 Number of successful extensions: 771 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -