BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1520 (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP prot... 24 4.5 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 23 7.9 >AJ439060-4|CAD27755.1| 151|Anopheles gambiae putative sRNP protein. Length = 151 Score = 24.2 bits (50), Expect = 4.5 Identities = 11/40 (27%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +3 Query: 342 FFCEFCNKYLS--TIIKGRFHVTGNEHIRNKGAYLFERLE 455 ++C++C+ YL+ + + H TG +H N Y + +E Sbjct: 4 YYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWME 43 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/27 (40%), Positives = 19/27 (70%), Gaps = 2/27 (7%) Frame = +3 Query: 264 EHKKSLEASSFVAEFI--EDRIRKVKK 338 E +K++EAS FVA+ + +D+ VK+ Sbjct: 467 EMEKTIEASRFVAQHVRNKDKFESVKE 493 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 794,518 Number of Sequences: 2352 Number of extensions: 16664 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -