BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1519 (596 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 9.9 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 9.9 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 9.9 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 22.6 bits (46), Expect = 9.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 333 WKLFL*RRW*CIPRCFHTNIFTSR 404 WK RR IPR + TN+ SR Sbjct: 312 WKFASIRRTMTIPRSYGTNVRESR 335 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 22.6 bits (46), Expect = 9.9 Identities = 14/49 (28%), Positives = 19/49 (38%) Frame = +2 Query: 35 NFCCILRYLPNYKFDLEVQQNLEVRSTKFLILSIKMLLRTSRSAHVFRG 181 N C+L YLP D ++ R + + SI TS S G Sbjct: 378 NCGCVLYYLPKLYEDTKICSRANARCYEQIRSSIAFTANTSISCSCLPG 426 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 22.6 bits (46), Expect = 9.9 Identities = 14/49 (28%), Positives = 19/49 (38%) Frame = +2 Query: 35 NFCCILRYLPNYKFDLEVQQNLEVRSTKFLILSIKMLLRTSRSAHVFRG 181 N C+L YLP D ++ R + + SI TS S G Sbjct: 378 NCGCVLYYLPKLYEDTKICSRANARCYEQIRSSIAFTANTSISCSCLPG 426 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 618,222 Number of Sequences: 2352 Number of extensions: 11217 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -