BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1518 (752 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 23 3.5 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 8.0 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +2 Query: 14 DPILVLENGSFCAWPERPLLEIDYSCWM 97 +P + E+ +F W E+ ++E + CW+ Sbjct: 467 NPRTITESKNFEPWREKCVVEGNPHCWV 494 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 Query: 182 VTTVQSAKCLRIDFWISASVFGSTLAVASS 93 V V S KC W S VF S + ++ S Sbjct: 212 VNGVTSEKCNLTFSWYSKKVFYSKIIISGS 241 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,822 Number of Sequences: 336 Number of extensions: 3658 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -