BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1517 (648 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.9 AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory recept... 23 2.9 AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 ... 23 2.9 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 5.0 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 5.0 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 245 ENLLYATIWVRSFSSLWRCL 304 ENL + ++ F S+W+CL Sbjct: 289 ENLEQSRYFIYMFVSVWKCL 308 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 245 ENLLYATIWVRSFSSLWRCL 304 ENL + ++ F S+W+CL Sbjct: 289 ENLEQSRYFIYMFVSVWKCL 308 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 245 ENLLYATIWVRSFSSLWRCL 304 ENL + ++ F S+W+CL Sbjct: 289 ENLEQSRYFIYMFVSVWKCL 308 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 245 ENLLYATIWVRSFSSLWRCL 304 ENL + ++ F S+W+CL Sbjct: 289 ENLEQSRYFIYMFVSVWKCL 308 >AM292352-1|CAL23164.1| 250|Tribolium castaneum gustatory receptor candidate 31 protein. Length = 250 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -1 Query: 552 HKTDNSICENLKISTLMYNCILLVGVFG 469 H T N + + L+ C + V +FG Sbjct: 31 HTTSNKQLQFFAVEHLLIQCYIAVSIFG 58 >AF263515-1|AAF74207.1| 126|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 126 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +1 Query: 433 VLALISFAINVLAKYPYEKDTVVHQGGD 516 V + I+FA+ VLA +P ++ +V + D Sbjct: 1 VSSAINFALMVLANHPTVQEEIVQEMKD 28 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 492 YSCTSGWRFLDFHISNYPSYVLGNSIEFCL 581 Y+ +S F + S +P+Y+ S+ FC+ Sbjct: 47 YNTSSVSNFNESSSSVFPNYIRTTSMVFCI 76 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 492 YSCTSGWRFLDFHISNYPSYVLGNSIEFCL 581 Y+ +S F + S +P+Y+ S+ FC+ Sbjct: 47 YNTSSVSNFNESSSSVFPNYIRTTSMVFCI 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,503 Number of Sequences: 336 Number of extensions: 3296 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -