BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1517 (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56814| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_39695| Best HMM Match : Pecanex_C (HMM E-Value=0) 32 0.46 SB_32865| Best HMM Match : AA_permease (HMM E-Value=7.7e-07) 27 9.9 SB_49146| Best HMM Match : GntR (HMM E-Value=1.8e-16) 27 9.9 >SB_56814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 483 Score = 37.5 bits (83), Expect = 0.009 Identities = 12/38 (31%), Positives = 24/38 (63%) Frame = +1 Query: 265 NLGPFIQFFVALFVNLFLYPFIATQWVPFSELCVLSFF 378 ++ P+I FF+ L + + ++P W+P SEL +++ F Sbjct: 405 SIRPYISFFICLLITVAVFPLCDKSWIPCSELSLVALF 442 >SB_39695| Best HMM Match : Pecanex_C (HMM E-Value=0) Length = 1048 Score = 31.9 bits (69), Expect = 0.46 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 6/76 (7%) Frame = +1 Query: 352 SELCVLSFFLMFLTLCSFGANGNPYPD-----VLALISFAINVLAK-YPYEKDTVVHQGG 513 SE ++ +F M + + A NPYP +L LISF A Y T +H Sbjct: 218 SETFLIDYFFMSIVITKIVAQANPYPKRCELYILCLISFVNRACASAMGYRPPTAIHATL 277 Query: 514 DF*IFTYRIIRLMSSG 561 F Y R SG Sbjct: 278 SFVDILYLTKRYFPSG 293 >SB_32865| Best HMM Match : AA_permease (HMM E-Value=7.7e-07) Length = 642 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 334 TQWVPFSELCVLSFFLMFLTLCSFGAN 414 T +PF + + ++F TL SFGAN Sbjct: 114 TGLLPFPDFVAFAIVMIFTTLASFGAN 140 >SB_49146| Best HMM Match : GntR (HMM E-Value=1.8e-16) Length = 410 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 647 IASARHQHQNDRYQXRKEHSTVQTKLYAIP 558 + S++H+ Q D+ + + EH T Q K A+P Sbjct: 255 LLSSQHRDQLDKLRVQIEHQTAQMKHVALP 284 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,786,035 Number of Sequences: 59808 Number of extensions: 419345 Number of successful extensions: 884 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -