BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1517 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 26 1.2 AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 prot... 24 3.6 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 25.8 bits (54), Expect = 1.2 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 191 WSGLFLRYSDGNLQPDESENLLYATIWVRSFSSL 292 W G L Y DGN P +++L A VR FS+L Sbjct: 825 WDGYSLLYVDGNDYP-HNQDLGSAGSCVRKFSTL 857 >AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 protein. Length = 100 Score = 24.2 bits (50), Expect = 3.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 158 HAKRQFIDFRKWSGL 202 HA R + D+R W+GL Sbjct: 56 HALRPYNDYRSWAGL 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,001 Number of Sequences: 2352 Number of extensions: 13443 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -