BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1516 (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_5283| Best HMM Match : Ank (HMM E-Value=3.1e-09) 35 0.061 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_15867| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_55202| Best HMM Match : FIVAR (HMM E-Value=3.7) 34 0.11 SB_42638| Best HMM Match : Filament (HMM E-Value=5.5) 33 0.19 SB_18982| Best HMM Match : M (HMM E-Value=1.1e-06) 33 0.19 SB_58526| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_45837| Best HMM Match : Fez1 (HMM E-Value=0.77) 33 0.33 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 32 0.43 SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) 32 0.57 SB_40974| Best HMM Match : KE2 (HMM E-Value=0.88) 32 0.57 SB_29083| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) 31 0.75 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 31 0.75 SB_55733| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00036) 31 0.99 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_2320| Best HMM Match : TFIID_20kDa (HMM E-Value=2.2) 31 0.99 SB_58681| Best HMM Match : MAP65_ASE1 (HMM E-Value=3.3e-26) 31 0.99 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 31 0.99 SB_29722| Best HMM Match : HLH (HMM E-Value=4.9e-14) 31 1.3 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 31 1.3 SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) 30 1.7 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 30 1.7 SB_51317| Best HMM Match : E-MAP-115 (HMM E-Value=0.58) 30 1.7 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) 29 3.0 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 29 3.0 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 3.0 SB_24402| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.0 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 29 4.0 SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) 29 5.3 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 29 5.3 SB_26577| Best HMM Match : Vicilin_N (HMM E-Value=1.5) 29 5.3 SB_15422| Best HMM Match : TACC (HMM E-Value=6.4e-20) 29 5.3 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) 29 5.3 SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) 29 5.3 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 28 7.0 SB_47796| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 28 7.0 SB_22316| Best HMM Match : fn3 (HMM E-Value=0.0034) 28 7.0 SB_37103| Best HMM Match : DUF164 (HMM E-Value=0.26) 28 7.0 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 28 9.2 SB_7462| Best HMM Match : PspA_IM30 (HMM E-Value=0.15) 28 9.2 SB_53408| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 9.2 SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) 28 9.2 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_46602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1805 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = +2 Query: 341 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQS---CSNERDILKANLSVKTLEYDE 508 L EK +K+++E+TDL+ KH ++S+E + E +S + E + ++ L K E +E Sbjct: 895 LREKLEKLETEYTDLEKKHSQISEEKAIVAEQLESEREVAQETEEMRQRLQTKKNELEE 953 >SB_5283| Best HMM Match : Ank (HMM E-Value=3.1e-09) Length = 481 Score = 35.1 bits (77), Expect = 0.061 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +2 Query: 302 KIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSN 454 +I D +A+ + L++ ++MK E + LK+K DE +K+++ SC++ Sbjct: 404 QIQAKDIEAQISTKLKEIERMKLEVSSLKNKRKRCDDECDKLRKRLHSCAS 454 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 34.7 bits (76), Expect = 0.081 Identities = 17/53 (32%), Positives = 34/53 (64%) Frame = +2 Query: 344 LEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 502 L K K+++ DLK+K+L +S ++++ + S+ RD+ + +L+V TL+Y Sbjct: 787 LTKESKLQTSIRDLKEKNLALSRLNSELQQEVKQVSHARDVTQYSLTV-TLKY 838 >SB_15867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 34.7 bits (76), Expect = 0.081 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +1 Query: 517 NFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVL 696 N D + N D + K K +E T + + S+ DQV ++ +R+ S QE+ L V Sbjct: 55 NLDTQGSHNIDREYKPKTMEYTTRDMGELSYSEDQVTLAISQIRKTAFSSQEQLYLLLVY 114 Query: 697 TD 702 D Sbjct: 115 ND 116 >SB_55202| Best HMM Match : FIVAR (HMM E-Value=3.7) Length = 145 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/60 (26%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = +1 Query: 532 KTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDL-NSLRRRHSSLQEEAEALRVLTDQL 708 K+ NE+LQ+ TK++ + +KQK+ E+ ++ D ++ ++E + AL + D++ Sbjct: 23 KSLNENLQKATKMINAIDKQIKQKTKEIKEIFDDAKKKAEQKLRDIEEASSALGAIEDKV 82 >SB_42638| Best HMM Match : Filament (HMM E-Value=5.5) Length = 252 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +1 Query: 526 VMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVL 696 ++K EN + + + + L+ LK L Q++ DL S+R + SLQ+E +RVL Sbjct: 180 LLKKENMEKKLEEEKLDFCENELKDMRMFLAQMERDLASIRDQTDSLQDEITEIRVL 236 >SB_18982| Best HMM Match : M (HMM E-Value=1.1e-06) Length = 825 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 6/84 (7%) Frame = +1 Query: 508 IKVNFDVMKTENEDL-QRKTKLLEEVTFSLKQKSFELD----QVQTDLNSLRRRHSSLQE 672 +K + ++ E ++L + K L +E+ F Q + L+ Q + D+N H L+ Sbjct: 190 LKARLEALENEKQELLEDKKDLNDEIKFLKYQLQYRLEVQNLQSERDMNQQSESHVKLEN 249 Query: 673 EAEALRVLTDQLKKCLN-MTTKIS 741 E +ALR LK+ L+ + TK++ Sbjct: 250 ENKALREENKDLKERLSVIRTKLT 273 >SB_58526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 33.5 bits (73), Expect = 0.19 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = +1 Query: 526 VMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVL 696 ++K EN + + + + L+ LK L Q++ DL S+R + SLQ+E +RVL Sbjct: 180 LLKKENMEKKLEEEKLDFCENELKDMRMFLAQMERDLASIRDQTDSLQDEITEIRVL 236 >SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2437 Score = 33.5 bits (73), Expect = 0.19 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 135 SDVDKKNLITNHTRPLRNGPPVSAAAPRIKRS 230 S+VD L+T+ R LRN P+SA P I+R+ Sbjct: 1464 SEVDPAQLLTDIQRKLRNDSPMSAGTPEIERA 1495 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 33.5 bits (73), Expect = 0.19 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 6/84 (7%) Frame = +1 Query: 508 IKVNFDVMKTENEDL-QRKTKLLEEVTFSLKQKSFELD----QVQTDLNSLRRRHSSLQE 672 +K + ++ E ++L + K L +E+ F Q + L+ Q + D+N H L+ Sbjct: 168 LKARLEALENEKQELLEDKKDLNDEIKFLKYQLQYRLEVQNLQSERDMNQQSESHVKLEN 227 Query: 673 EAEALRVLTDQLKKCLN-MTTKIS 741 E +ALR LK+ L+ + TK++ Sbjct: 228 ENKALREENKDLKERLSVIRTKLT 251 >SB_45837| Best HMM Match : Fez1 (HMM E-Value=0.77) Length = 264 Score = 32.7 bits (71), Expect = 0.33 Identities = 16/66 (24%), Positives = 36/66 (54%) Frame = +2 Query: 266 VTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQS 445 ++KV+ + +A D K F +L ++ K+++ +DK+ ++S E+E++KE + Sbjct: 50 ISKVKPKQYLALLQNFTDLKVEFLNLEDEKHKLENALLRSEDKYAKLSQEHEQLKEKYSE 109 Query: 446 CSNERD 463 + D Sbjct: 110 LEHLED 115 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 32.3 bits (70), Expect = 0.43 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = +1 Query: 511 KVNFDVMKTEN--EDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEA 678 +VN D+ + ++ +L TK +EE ++ + DQ+Q L L+R+H + QE+A Sbjct: 209 QVNADLKRIDHLEHELMISTKTVEEHVITINEMKVGKDQLQDSLYELKRKHQA-QEDA 265 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/67 (22%), Positives = 35/67 (52%), Gaps = 4/67 (5%) Frame = +1 Query: 526 VMKTENEDLQRKTKL----LEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRV 693 +++ EN+ L+ + + E + + +++++Q +L + +RH+ L+ EAL Sbjct: 1424 LLRAENDKLKNDVRAYQTQISEYKANYQNAQKDIEKIQLELLTANQRHNHLEARTEALED 1483 Query: 694 LTDQLKK 714 +LKK Sbjct: 1484 DKQRLKK 1490 >SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) Length = 732 Score = 31.9 bits (69), Expect = 0.57 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +1 Query: 532 KTENEDLQRKTKLLEEVTFSLKQKSFELDQVQ-TDLNSLRRRHSSLQ 669 K + E Q+KT+L+E+ +++ ELDQVQ +L +R+ SS+Q Sbjct: 393 KNQYELQQKKTELIEKHEKAMEDVLTELDQVQNAELGETKRKMSSVQ 439 >SB_40974| Best HMM Match : KE2 (HMM E-Value=0.88) Length = 106 Score = 31.9 bits (69), Expect = 0.57 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +1 Query: 508 IKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRH 657 ++ D K ++ L+R+ LE L+Q+ E DQ++ D++ L+RRH Sbjct: 25 LRKELDNSKKDHLSLERR---LEATEHELRQRVTECDQLRDDMDELQRRH 71 >SB_29083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.75 Identities = 20/71 (28%), Positives = 36/71 (50%) Frame = +1 Query: 529 MKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTDQL 708 MK E + L+ + +LE + K+ DQ++ D+ L ++ LQ AE + L D++ Sbjct: 28 MKQEIDQLKEENFILETARDEYRIKA---DQLERDVEILNEKNEQLQGLAEESQQLKDEM 84 Query: 709 KKCLNMTTKIS 741 +M K+S Sbjct: 85 DVLRHMQEKVS 95 >SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11) Length = 1491 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = +1 Query: 529 MKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTDQL 708 +K ED+ ++ E+ +++ ELD V T N L+++ + +E + L ++L Sbjct: 556 LKERLEDMAKEKTRRRELEKKIEELQDELDDVSTRRNELQKKQEKIIKENDELNDRINEL 615 Query: 709 KK 714 KK Sbjct: 616 KK 617 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/61 (24%), Positives = 31/61 (50%) Frame = +2 Query: 317 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTL 496 D R N+L +K +K+ E +L D+ E+ E + + + + +N+R ++ + K Sbjct: 586 DVSTRRNELQKKQEKIIKENDELNDRINELKKENDYLAKEIKDFANKRKEMETSYEEKER 645 Query: 497 E 499 E Sbjct: 646 E 646 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 31.5 bits (68), Expect = 0.75 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +1 Query: 544 EDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALR 690 E LQR+T LE++ + +L+ ++ + S R S LQEE + L+ Sbjct: 4308 EALQRRTDELEKLQSQTRSLQSQLELIEKEKESWESRESELQEELQHLQ 4356 Score = 31.1 bits (67), Expect = 0.99 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +1 Query: 508 IKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQ--VQTDLNSLRRRHSSLQEEAE 681 +K+ +V E E+L+R T L + L Q + Q +++D + + LQ+E + Sbjct: 4230 LKMKLEVKVNECEELERTTSDLSK---KLSQAELIVQQLSIESDAPAAQTLVQQLQQEKD 4286 Query: 682 ALRVLTDQLKKCL 720 L+ DQLKK L Sbjct: 4287 DLKSKLDQLKKTL 4299 >SB_55733| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00036) Length = 1211 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +2 Query: 323 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANL 481 K L+E +K+ +E L+D ++ EY+ K +++ NER+ L L Sbjct: 765 KENIRSLVEDREKLMNENKSLQDTWCKMRLEYQTAKVEYEALRNEREALAKEL 817 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/46 (34%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +1 Query: 610 ELDQVQTDL-NSLRRRHSSLQEEAEALRVLTDQLKKCLNMTTKISL 744 EL ++Q +L NS+RR S++ E E VL+++++ N+ TK+ + Sbjct: 98 ELVRLQGELKNSIRRNEDSMRGEREERLVLSEKIQAANNLYTKLMM 143 >SB_2320| Best HMM Match : TFIID_20kDa (HMM E-Value=2.2) Length = 161 Score = 31.1 bits (67), Expect = 0.99 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +2 Query: 344 LEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSV 487 L + +++KS F D K EV YE+IKE FQ ++++ ++ L V Sbjct: 57 LNQLEEVKSCFKDGKKSKAEVRVLYERIKERFQDIQDKQERIEICLEV 104 >SB_58681| Best HMM Match : MAP65_ASE1 (HMM E-Value=3.3e-26) Length = 631 Score = 31.1 bits (67), Expect = 0.99 Identities = 21/64 (32%), Positives = 33/64 (51%) Frame = +1 Query: 523 DVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTD 702 +VMK E+ + K++E+ K K EL+ Q D+N R +L +E + RVL Sbjct: 317 EVMKGFFEENKHMFKMVEKRETMFK-KMEELELKQNDVNRFSNRGGALLKECRSRRVLEK 375 Query: 703 QLKK 714 +L K Sbjct: 376 ELPK 379 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 31.1 bits (67), Expect = 0.99 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = +2 Query: 323 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKT 493 K N L K K E +DL+D+ E YEK+ Q E + K L+ +T Sbjct: 671 KNEINSLKAKLAKANDELSDLRDELSETKQGYEKV---MQKAKQEASLFKEKLNEET 724 >SB_29722| Best HMM Match : HLH (HMM E-Value=4.9e-14) Length = 106 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +3 Query: 168 HTRPLRNGPPVSAAAPRIKRSATAPSSTTF--RIM*QKLKKDQLWLRKSL 311 HT PLR+ P PR + S PS+ RI Q LKK + L+K+L Sbjct: 4 HTIPLRHQPEEIFLKPRKRASYDQPSANAIRERIRAQNLKKAYMELQKTL 53 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/60 (25%), Positives = 29/60 (48%) Frame = +1 Query: 544 EDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTDQLKKCLN 723 + LQ K + E+ L +++QTDL + S E+ EAL+ ++L + ++ Sbjct: 595 QQLQEKQSRISELEQELASNQLSYEELQTDLEFTKAELQSTVEDNEALKKQVEELTETIH 654 >SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 2532 Score = 30.3 bits (65), Expect = 1.7 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = +1 Query: 517 NFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEAL 687 NF + K E E ++++ K LEE EL+++ + R SSLQEEAE + Sbjct: 1344 NFHLSKRELEKIEKELKALEE----------ELERLGKQYDDAMREKSSLQEEAEIM 1390 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 30.3 bits (65), Expect = 1.7 Identities = 10/35 (28%), Positives = 25/35 (71%) Frame = +2 Query: 338 DLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQ 442 ++L ++ ++K E LK++H E++++ EK+K+ + Sbjct: 1939 EVLTENDRLKEENKTLKEEHTELAEQNEKLKDALE 1973 >SB_51317| Best HMM Match : E-MAP-115 (HMM E-Value=0.58) Length = 696 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +1 Query: 508 IKVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRH 657 ++ D K ++ +R+ LE L+Q+ E DQ++ D++ L+RRH Sbjct: 239 LRKELDNSKKDHLSFERR---LEATEHELRQRVTECDQLRDDMDELQRRH 285 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Frame = +2 Query: 275 VEKRSTVAPKIPPYDFKARFN-DLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCS 451 ++K V + P N + LE KK+K E KDK ++D +++ S S Sbjct: 3423 LDKAEPVLGSLEPVSGDVNKNKEELENVKKLKEELEGAKDKLNSLNDAERVLEDALTSVS 3482 Query: 452 NERDILKANLSVKTLEYDE 508 + ++ L+ T +Y + Sbjct: 3483 GDPSTVQEELAAVTQKYHD 3501 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 Query: 341 LLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKA 475 L +K ++++ F KDK E + EK++ Q E DI++A Sbjct: 2866 LQDKISELEAGFGSAKDKAAERQGKLEKVEPEAQQFRQEADIIRA 2910 >SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 29.9 bits (64), Expect = 2.3 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +2 Query: 347 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDE 508 E+ KK K E K+ +V E EK+K +S NE+ + L K L DE Sbjct: 41 EEEKKRKREVEKKKETVEDVKIEIEKLKAKLESLKNEKHQMFLQLK-KVLSEDE 93 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +1 Query: 550 LQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEE 675 ++ + LEE+ F L +KS +L+++ + L+ + +SL+EE Sbjct: 2300 IEEHEEQLEEMQFLLDKKSKKLERITKESKDLKEKVTSLEEE 2341 >SB_33687| Best HMM Match : Filament (HMM E-Value=0.1) Length = 700 Score = 29.5 bits (63), Expect = 3.0 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +2 Query: 317 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQS-CSN-ERDILKANLSVK 490 D + RF+ L K K M E T K+ ++ S E+E+ F+S CS +++ + N ++ Sbjct: 389 DQQKRFDTLWVKAKSMMDEETKHKENAIKRSKEFEERSHYFESQCSTLAKELEQRNNTII 448 Query: 491 TLE 499 LE Sbjct: 449 MLE 451 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +2 Query: 245 IDNIPNNVTKVEKRSTVAPKIPPY-DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYE 421 +DN+ N K + S +A P D + + D E++ ++K E DL++K YE Sbjct: 2291 MDNM--NAEKRDHMSELARAQPQIADLENKLQDAREQNSRLKIEIDDLRNKLSSAKSRYE 2348 Query: 422 KIK 430 +++ Sbjct: 2349 RVE 2351 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.5 bits (63), Expect = 3.0 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +1 Query: 523 DVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTD 702 + + TE ED+ +T L EEV +L + E+ + + +S R S Q + + + D Sbjct: 1375 EFLMTEMEDIPTETSLDEEVLLNLPENRREMKEDIAEKSSTEVRQISSQIRSSSRNHILD 1434 Query: 703 Q-LKKC 717 LK C Sbjct: 1435 HILKNC 1440 >SB_24402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 Query: 329 RFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLS 484 +F +L+ K + F+DL K E+ DE+ ET +S ++L LS Sbjct: 184 QFQAMLQTQKSLGDTFSDLGMKSPELQDEFNYNAETQKSLIKNGEVLLGALS 235 >SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 587 Score = 29.1 bits (62), Expect = 4.0 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +1 Query: 523 DVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHS-SLQEEAEALRVLT 699 D++ TEN+DL++ ++ E T + S DQ+Q L R S ++ + V + Sbjct: 220 DLVFTENQDLKKHRQIHSEQTKKTFRCSKCSDQIQGKKEYLEHRKSHPIERKIHKCEVCS 279 Query: 700 DQLKKCLNM 726 KC N+ Sbjct: 280 RVFNKCSNL 288 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 29.1 bits (62), Expect = 4.0 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 1/78 (1%) Frame = +1 Query: 511 KVNFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALR 690 ++ F+V + EN+DLQ++ LE+ T +L+ E+ + ++L SLR +S + + Sbjct: 2314 QLRFEVAQQENDDLQKELCNLEKKTQTLET---EIKKNGSELASLRIENSESKSRFTQIN 2370 Query: 691 VLTDQLKKCL-NMTTKIS 741 L+K L N T +I+ Sbjct: 2371 HEVLSLQKDLANKTAQIT 2388 >SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) Length = 458 Score = 28.7 bits (61), Expect = 5.3 Identities = 15/62 (24%), Positives = 31/62 (50%) Frame = +2 Query: 323 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEY 502 K + DL + + ++ +DL++K V +E ++K F ++ + N S T EY Sbjct: 182 KRQVKDLEMEKQSLEKSVSDLREKVKLVENEKSELKFAFDELDSKYRVCDENRSSITNEY 241 Query: 503 DE 508 ++ Sbjct: 242 ED 243 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = +2 Query: 347 EKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYDE 508 EK +++ + T L+ + E S E EK+K+T Q + + LK K+ E D+ Sbjct: 1339 EKVQELLHKVTYLEGELKERSVETEKLKQTLQEREEQIERLKEEFQEKSRELDK 1392 >SB_26577| Best HMM Match : Vicilin_N (HMM E-Value=1.5) Length = 649 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/50 (34%), Positives = 32/50 (64%) Frame = +1 Query: 526 VMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEE 675 +M+ +NE K K LE+V+ +Q+ EL++++++LN +R + QEE Sbjct: 499 LMQRDNELRSSKRKKLEKVS---RQRE-ELERMESELNDWQRNLKAYQEE 544 >SB_15422| Best HMM Match : TACC (HMM E-Value=6.4e-20) Length = 1362 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 610 ELDQVQTDLNSLRRRHSSLQEEAEALRVLTDQLKK 714 E DQ+Q DLNS+ S L + L+ + + KK Sbjct: 335 ERDQLQADLNSVEAAFSDLHRRYDKLKGVVENFKK 369 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/59 (28%), Positives = 33/59 (55%) Frame = +1 Query: 544 EDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTDQLKKCL 720 E +Q K + + +++ +KQ + + + +Q +L+ RHS LQE+ E + L+ CL Sbjct: 1804 ELIQAKKEEIAQLSAQVKQWNEKHEALQRNLDDHDLRHSQLQEQYEFKCNEVEVLQDCL 1862 >SB_2355| Best HMM Match : Carn_acyltransf (HMM E-Value=0) Length = 1559 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 96 HNRPISRTIANGLSDVDKKNLITNHTRPLRNGPPVSAAAPRIKR 227 +N+ R + N D D + IT P N PPV+ AAP+ +R Sbjct: 14 NNKYSRRNLPN--PDNDNTSYITPQAAPNTNPPPVATAAPQRRR 55 >SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/62 (25%), Positives = 36/62 (58%) Frame = +1 Query: 529 MKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTDQL 708 ++ E +DL+++ ++L++V ++ +DQ + L L +RHS+ +R L ++L Sbjct: 184 LQQEVDDLRKENRMLKKVNMRQERDLRHVDQEEAALPMLLQRHSA------EMRTLRERL 237 Query: 709 KK 714 K+ Sbjct: 238 KR 239 >SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) Length = 758 Score = 28.7 bits (61), Expect = 5.3 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = +1 Query: 571 LEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTDQLKKCLNMT 729 LEE S EL + Q +S R + +S +EE EALR LK L +T Sbjct: 551 LEETKESNSSMLVELHEAQRQNSSDRAKIASYREEIEALRHENKVLKGTLEIT 603 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Frame = +1 Query: 529 MKTENEDLQRKTKLLEEVTFSLKQKSFE----LDQVQTDLNSLRRRHSSLQEEAEALRVL 696 + +E EDL++KTKLL + L K L+ +T+ LR+ ++ E L Sbjct: 1669 LHSEKEDLEKKTKLLSDEMCRLANKEGHQTTLLEGYRTETEELRKTLELVKSSKETLAAH 1728 Query: 697 TDQLKK 714 + L++ Sbjct: 1729 SQSLQQ 1734 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 28.3 bits (60), Expect = 7.0 Identities = 15/58 (25%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +1 Query: 538 ENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEA-LRVLTDQL 708 E E +R+TKLL++ ++ DQ++ ++ SL+++ + + ++ +R+L DQ+ Sbjct: 417 ECEKHKRQTKLLQKEIDDQREAVAAKDQLEQEITSLKQQLEQQEADHQSTIRMLQDQI 474 Score = 28.3 bits (60), Expect = 7.0 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 9/82 (10%) Frame = +1 Query: 529 MKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNS--------LRRRHSSLQEEAEA 684 +K+ENE LQ+K LE+ ++KQ ++ + +L S L + ++LQ E E Sbjct: 1135 LKSENEGLQQKCLDLEKQRDTIKQDLADVQKEHENLKSAVSISEGELLKFKNTLQSEKEE 1194 Query: 685 L-RVLTDQLKKCLNMTTKISLL 747 + L+ L++ M +++S+L Sbjct: 1195 FEKKLSSLLEQLSEMESEVSVL 1216 >SB_47796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/58 (27%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +1 Query: 553 QRKTKLLEE-VTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVLTDQLKKCLN 723 +R TK+ ++ + ++++KS E+D+ + L S+ SL ++ VL D +C+N Sbjct: 19 RRTTKMTQKALQNAIERKSIEIDRSKRRLLSVIETSKSLSHDSNLDIVLHDLTTRCIN 76 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/78 (24%), Positives = 38/78 (48%), Gaps = 1/78 (1%) Frame = +1 Query: 517 NFDVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEALRVL 696 ++D+ E +L+ + + LEE + K ++ + TDL S Q A ++ L Sbjct: 120 SYDIANLERNELKTRNRDLEEEITAKKAALKQISRENTDLKSKLELLMKDQSGAAVIKDL 179 Query: 697 TDQLKKCL-NMTTKISLL 747 T Q+++ N+ K ++L Sbjct: 180 TRQVEELRENLKAKQAIL 197 >SB_22316| Best HMM Match : fn3 (HMM E-Value=0.0034) Length = 3404 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/75 (21%), Positives = 32/75 (42%) Frame = +2 Query: 236 CTIIDNIPNNVTKVEKRSTVAPKIPPYDFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDE 415 C +I IP V ++ + + + D+KA L + K + D+ LEV+ Sbjct: 2204 CVVITAIPKVVEVIDLENINSTNMKDIDYKADMESLTLRWKLLGRFLGDISRMKLEVAVT 2263 Query: 416 YEKIKETFQSCSNER 460 + E++ S + + Sbjct: 2264 HPSSNESYPSMDHSK 2278 >SB_37103| Best HMM Match : DUF164 (HMM E-Value=0.26) Length = 387 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 323 KARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNER 460 KA DL E H K+K + D+K+ ++S+ E+ K+ + E+ Sbjct: 244 KAMKGDLKEYHTKLKIAYGDIKELKQQMSEWTEERKQIKSELNREK 289 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/72 (25%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Frame = +1 Query: 529 MKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQ-EEAEALRVLTDQ 705 ++TEN L+ + +++EE S K L ++++ L + L+ +++E++R L+ Sbjct: 526 LETENRILENQVRMMEE---SNKDLYKNLHEIRSKLRIQESKVDELRIQKSESVRKLSQV 582 Query: 706 LKKCLNMTTKIS 741 L+ L+ T+ S Sbjct: 583 LQSSLDRNTRFS 594 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 27.9 bits (59), Expect = 9.2 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +1 Query: 520 FDVMKTENEDLQRKTKLLEEVTFSLKQKSFELDQVQTDLNSLRRRHSSLQEEAEAL 687 F+ +KTE + K + +E+V S+K+ ELD+ T L + S L + +A+ Sbjct: 753 FNALKTELTGVTTKLEEVEKV--SVKELEIELDRKNTRNRELEKELSKLNTKLDAV 806 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +2 Query: 317 DFKARFNDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIK 430 +FK R++ L ++ + +F D+K+K ++ + E IK Sbjct: 692 NFKERYSQLQNNYEILMEQFGDVKEKSEMLAQDMESIK 729 >SB_7462| Best HMM Match : PspA_IM30 (HMM E-Value=0.15) Length = 393 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +2 Query: 371 EFTDLKDKHLEVSDEYEKIKETFQSCSNERDILKANLSVKTLEYD 505 E +L+D ++ DE EKI + +++ E +I A + + E++ Sbjct: 110 ELEELRDDIEKLKDESEKILDNYRAIMEEAEIRNAEIKKVSYEFE 154 >SB_53408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +2 Query: 335 NDLLEKHKKMKSEFTDLKDKHLEVSDEYEKIKETFQSCSNERD 463 +D++ HKK KSE +L D L EY+ ++ ++ + + Sbjct: 1 SDIMATHKKYKSEVNELHDALLLGKREYDLMRIEYEQSAKTNE 43 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +2 Query: 317 DFKARFNDLLEKHKKMKSEFTDLKD--KHLEVSDE-YEKIKETFQSCSNERDILK 472 D + + L+K K LKD K+LE+ + YEK+KE F + E LK Sbjct: 386 DVSTKRKNSLDKRAAAKKMDKQLKDATKNLELEKKKYEKVKEQFTTTEQELKDLK 440 >SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) Length = 495 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = +2 Query: 347 EKHKKMKSEFTDLKDKHLEVSDEYEKI----KETFQSCSNERDILKANLSVKTLEYDE 508 E KKM +E D+K K+ E+S E+E++ E + +R+ L+ ++ +Y++ Sbjct: 78 ELGKKMLAENDDIKMKYGELSREHEEVVKELDEEITRVTTDRNNLRTSMKTLQAKYEQ 135 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/65 (23%), Positives = 36/65 (55%), Gaps = 7/65 (10%) Frame = +2 Query: 320 FKARFNDLLEKHKKMKSE----FTDLK---DKHLEVSDEYEKIKETFQSCSNERDILKAN 478 ++++ D K + +++E TDL+ +K + + E + +KE ++ RD++++ Sbjct: 564 YRSQIQDNTSKIESLEAEKRAITTDLESSIEKRVSIEKELQSVKEQLETGYRSRDVVESE 623 Query: 479 LSVKT 493 L+V T Sbjct: 624 LAVAT 628 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,272,364 Number of Sequences: 59808 Number of extensions: 295240 Number of successful extensions: 1299 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1293 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -