BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1513 (758 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0197 - 1417672-1417899,1418921-1418974,1419267-1419552,142... 30 2.3 10_01_0055 - 785172-785997,786859-787394,787478-787695,787789-78... 28 9.3 >05_01_0197 - 1417672-1417899,1418921-1418974,1419267-1419552, 1421768-1422291 Length = 363 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +3 Query: 438 CPICRDEYLVLDHRNTKLLQQFISIILDRFYNLQRQAYARKNTKNSWLLLK 590 C ICRDE L + L + ++F+ + Y R KN W LK Sbjct: 308 CEICRDEVLAGNRPTAALSPLGYKNLEEKFFAQTGRQYDRTKLKNRWDTLK 358 >10_01_0055 - 785172-785997,786859-787394,787478-787695,787789-787891, 788723-788770 Length = 576 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +3 Query: 552 ARKNTKNSW-LLLKELGTKVCLHMMYHS-EYMIIQFITKVLHPTRIDVIR 695 A K++ +W LG + C +M Y ++ F+T VLH +++D R Sbjct: 35 ALKHSTGNWRACFLILGVEFCENMTYFVISRNLVTFLTTVLHESKVDAAR 84 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,492,305 Number of Sequences: 37544 Number of extensions: 352019 Number of successful extensions: 946 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 920 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 943 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -