BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1512 (802 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 26 0.30 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 26 0.30 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.2 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 22 6.5 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 26.2 bits (55), Expect = 0.30 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 335 VKSNNYLQG-KSLIKLIRQHSTTKHNFLTSLISSRYLRSTKLLAPIIIL 192 + ++NYL S I L S + N +S + Y+R+T ++ III+ Sbjct: 31 ISTSNYLYTPSSTIDLYNTSSVSNFNESSSSVFPNYIRTTSMVFCIIIM 79 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 26.2 bits (55), Expect = 0.30 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 335 VKSNNYLQG-KSLIKLIRQHSTTKHNFLTSLISSRYLRSTKLLAPIIIL 192 + ++NYL S I L S + N +S + Y+R+T ++ III+ Sbjct: 31 ISTSNYLYTPSSTIDLYNTSSVSNFNESSSSVFPNYIRTTSMVFCIIIM 79 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +3 Query: 414 FVALYNLFLNRLLYCKTFQRVIDMYEIYFAINLKTYFCLHHFFTNALVLP 563 F + +F LL+C F I+F ++L CL +F + L LP Sbjct: 169 FFCAFIIFTMHLLFCCAF--------IFFNMHLLFLLCLDYFTLHLLFLP 210 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/36 (22%), Positives = 19/36 (52%) Frame = +3 Query: 492 IYFAINLKTYFCLHHFFTNALVLPLSKITPKPYMYF 599 I F ++L C++HFF ++ + + +++F Sbjct: 154 IIFTVHLLFLLCIYHFFCAFIIFTMHLLFCCAFIFF 189 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 21.8 bits (44), Expect = 6.5 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 76 LYPYIHILSKAINK 117 LYP +H++S+A+ + Sbjct: 58 LYPSVHLISRALGE 71 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,319 Number of Sequences: 336 Number of extensions: 3787 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -