BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1512 (802 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 29 3.3 SB_8849| Best HMM Match : F-box (HMM E-Value=0.86) 29 5.8 SB_59452| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 465 MFYSIKADLKIDYTKLQSFDLHSYMICI 382 +F SIKA L I+Y + + DLH + C+ Sbjct: 1 VFSSIKATLNIEYFDVSTQDLHELLACL 28 >SB_8849| Best HMM Match : F-box (HMM E-Value=0.86) Length = 1222 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 151 IYSIALHTFSKICLLL*IIYVCMDIIPTTKIIILNLSMLIKKKNDIITV 5 I SI + + ++ II + + I P+ III+N+S + K + +I + Sbjct: 925 IMSITADIITIVIIIAVIIIIIITICPSIVIIIINISFVTKSTSIVIII 973 >SB_59452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 101 DNICMYGYNTYHKNYYIE 48 D +C YG T++K YY+E Sbjct: 85 DQLCPYGQYTFYKEYYME 102 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,003,338 Number of Sequences: 59808 Number of extensions: 378510 Number of successful extensions: 882 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -