BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1508 (802 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0739 + 22675145-22675295,22676350-22676447 29 4.3 >12_02_0739 + 22675145-22675295,22676350-22676447 Length = 82 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = -3 Query: 269 RSRSTRHLLSDSGNTILEMCGIFSIIIGM-WYRL*KRCRHSTQSVSNRNYSKRNSERIT* 93 R+R +L S ++ IF+ I G+ WY + + +H + +K SER++ Sbjct: 15 RARVEHYLYSGEKKHVVAGIAIFAAIFGVPWYLMTRGAKHQSHQDYMERANKARSERLSS 74 Query: 92 SESEQAK 72 ++ K Sbjct: 75 GQASSPK 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,200,167 Number of Sequences: 37544 Number of extensions: 291926 Number of successful extensions: 507 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -