BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1508 (802 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81479-3|CAB03942.1| 283|Caenorhabditis elegans Hypothetical pr... 28 8.9 Z81479-2|CAB03941.1| 283|Caenorhabditis elegans Hypothetical pr... 28 8.9 >Z81479-3|CAB03942.1| 283|Caenorhabditis elegans Hypothetical protein C34F6.3 protein. Length = 283 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -1 Query: 184 CGIGYKSVAGIARSQLVIGTTRSETANGSPEANRNKRNESFKVFVECFKC 35 CGIG AG+ + G G+P A+ +++ +K CF C Sbjct: 90 CGIGETGPAGVPGQEGAPGNDGKAGQPGAPGADADEQGFHYKAPEFCFDC 139 >Z81479-2|CAB03941.1| 283|Caenorhabditis elegans Hypothetical protein C34F6.2 protein. Length = 283 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -1 Query: 184 CGIGYKSVAGIARSQLVIGTTRSETANGSPEANRNKRNESFKVFVECFKC 35 CGIG AG+ + G G+P A+ +++ +K CF C Sbjct: 90 CGIGETGPAGVPGQEGAPGNDGKAGQPGAPGADADEQGFHYKAPEFCFDC 139 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,662,660 Number of Sequences: 27780 Number of extensions: 283552 Number of successful extensions: 565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 565 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1956310428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -