Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1503
         (861 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7R9H7 Cluster: Serine/threonine-protein kinase; n=3; P...    34   4.0  

>UniRef50_Q7R9H7 Cluster: Serine/threonine-protein kinase; n=3;
            Plasmodium (Vinckeia)|Rep: Serine/threonine-protein
            kinase - Plasmodium yoelii yoelii
          Length = 996

 Score = 34.3 bits (75), Expect = 4.0
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 2/63 (3%)
 Frame = +2

Query: 674  NTYNIIIMVTKVKYNIIAINKNLNYMKCL*FKW--CLFL*SDLNLCLFKGNLISVDNVSL 847
            NT+N++++  K KYNI  INK      C  +K   C  + +     LF    +S++N   
Sbjct: 926  NTHNLLLLQPKEKYNIFQINKTQVPTNCYHYKQTKCRLIKNQRKDLLFSDKRVSINNPKK 985

Query: 848  MIL 856
             I+
Sbjct: 986  CII 988


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 741,758,021
Number of Sequences: 1657284
Number of extensions: 13468725
Number of successful extensions: 32561
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 31270
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32545
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 76243001646
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)