BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1503 (861 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0679 + 20650513-20650719 29 4.8 10_08_1017 - 22268957-22269279,22269784-22269934,22270084-222701... 29 6.3 11_02_0089 + 8203056-8203535 28 8.3 >07_03_0679 + 20650513-20650719 Length = 68 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = -1 Query: 348 RRVVLPAASRSVVAGTDSDSWQCCVPASRPQGSRL 244 RR VL AAS V A S CVPA+R G +L Sbjct: 6 RRRVLTAASTLVPAACSSAGGMQCVPAARGGGRKL 40 >10_08_1017 - 22268957-22269279,22269784-22269934,22270084-22270164, 22271296-22271374,22273296-22273345 Length = 227 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 157 NSGTPHRPLTQHAPVRKYN*TLFTRKIQLK 68 N+ + LT++ PVRKYN T+ R + L+ Sbjct: 20 NNNSKEILLTKYTPVRKYNLTVILRNLNLR 49 >11_02_0089 + 8203056-8203535 Length = 159 Score = 28.3 bits (60), Expect = 8.3 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = -1 Query: 348 RRVVLPAASRSVVAGTDSDSWQCCVPASRPQGSRL 244 RR VL AAS V A S CVPA+R G +L Sbjct: 57 RRRVLTAASTLVPAACGSAGGMPCVPAARGGGRQL 91 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,701,444 Number of Sequences: 37544 Number of extensions: 361893 Number of successful extensions: 1027 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1005 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -