BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1503 (861 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_58221| Best HMM Match : TBC (HMM E-Value=2.9e-08) 28 8.5 >SB_47424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -1 Query: 774 HHLNYKHFI*FRFLLIAIMLYFTFVTIIIMLYVFV 670 HH + H + F +LI I++ T +TII+++ V V Sbjct: 137 HHHQHHHHL-FHIILITIIIIPTIITIIVIIIVVV 170 >SB_58221| Best HMM Match : TBC (HMM E-Value=2.9e-08) Length = 580 Score = 28.3 bits (60), Expect = 8.5 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -1 Query: 777 KHHLNYKHFI*FRFLLIAIMLYFTFVTIIIMLYVFVTKN*NESLHLVL 634 KH +F FR+LLI F+F I+ + F T+N + + HL++ Sbjct: 368 KHDSGNLYFC-FRWLLICFKREFSFDDIMTLWEAFWTQNLSPNFHLIV 414 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,111,686 Number of Sequences: 59808 Number of extensions: 421661 Number of successful extensions: 938 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -