BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1503 (861 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80027-12|AAC48126.2| 493|Caenorhabditis elegans Hypothetical p... 28 9.8 U29614-6|AAA68809.2| 378|Caenorhabditis elegans Hypothetical pr... 28 9.8 >U80027-12|AAC48126.2| 493|Caenorhabditis elegans Hypothetical protein T28A11.17 protein. Length = 493 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 614 AQREWGRRTKWSDSFQFFVTNTYNIIIMVTKVKYNIIAIN 733 A RE+ + S+ F F + N N+ + +T V YN + N Sbjct: 104 ATREYATKKNNSEKFSFALENLENLNLTLTNVFYNSLYAN 143 >U29614-6|AAA68809.2| 378|Caenorhabditis elegans Hypothetical protein F18E9.3 protein. Length = 378 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 200 KISTTYLTVSGSTLKLRHSTPTSHTTCARPKI 105 K TT T + T K+R STP +H+T R I Sbjct: 129 KKKTTTTTHAPLTTKMRESTPATHSTTERAVI 160 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,388,610 Number of Sequences: 27780 Number of extensions: 331156 Number of successful extensions: 786 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2150453690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -