BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1497 (832 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 2.6 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 22 8.0 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.4 bits (48), Expect = 2.6 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +1 Query: 220 FFMYSK---LYYNSFPMGHCLSCFKSQANAEIRSITG 321 FFM K YNSF G L Q A I S+TG Sbjct: 95 FFMMIKTPIFIYNSFNTGFALGNLGCQIFAVIGSLTG 131 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.8 bits (44), Expect = 8.0 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = +2 Query: 221 FLCIQNYITTVFQWATVSA--VSNLKLMLK*EVSQDPTQKMMR*QIYLFLCQFILKWSPF 394 FL + I VF + A V LK + K + + + + L + F+L WSP+ Sbjct: 68 FLFVLGLIVPVFTIVSSYAAIVLTLKKVRKRAGASGRREAKITKMVALMITAFLLAWSPY 127 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,538 Number of Sequences: 438 Number of extensions: 3870 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -