BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1493 (772 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 24 1.2 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 23 2.7 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 23 3.6 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 8.2 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 24.2 bits (50), Expect = 1.2 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 16 SSASSLHAPESRVRDVTCACPPPTYACLVSKHPALN 123 SS SS+ +P + T PPP Y + + ALN Sbjct: 127 SSTSSIPSPSTTDDLSTNPTPPPHYTYQIIPYEALN 162 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 369 ISFKN*VNTIRDLSCDGPN 425 I+ KN N IRD +GPN Sbjct: 344 ITSKNVANKIRDFYYEGPN 362 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 22.6 bits (46), Expect = 3.6 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 14 RVRRPVSMRRSHVSE---TSRVRALLQRMPVSSPNILPSTRLCEYNRL 148 R RP R + E + RV A L V+SP P R C NRL Sbjct: 213 RTPRPKHDGRGRIVERFTSDRVHAAL----VTSPRARPLARTCRDNRL 256 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 704 PGACCPRCGGAL 739 PG CC C G L Sbjct: 101 PGRCCKTCPGDL 112 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/34 (29%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 662 CPALK-KDDCQGFTAPGACCPRCGGALRILYSKK 760 CP + D+ + PG CC C A ++ S + Sbjct: 710 CPQVTCPDNMKLEKVPGECCAICVNATSLVESNR 743 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,705 Number of Sequences: 336 Number of extensions: 4302 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -