BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1493 (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 27 0.64 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 26 1.5 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 25 3.4 AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic pr... 23 7.9 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 7.9 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 27.1 bits (57), Expect = 0.64 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 599 CLAVGYISDQMEPKCTFDRIVCPALKKDDCQGF-TAPGACCPRCGGALRILY 751 C+A G I+D + + +R +K+ C G T P CCPR A R Y Sbjct: 58 CVAYGKIND-VSSLSSIERF--SFIKQIQCNGSDTVPYVCCPRDSDAYREPY 106 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 25.8 bits (54), Expect = 1.5 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = +1 Query: 61 VTCACPPPTYACLVSKHPALNTFV*IQQTAIRKPLCRCVTLMAEHMRTPAIL 216 ++CA PP A + S +P L + IQQ + P T T +L Sbjct: 878 ISCAGNPPNIAAVSSTYPCLR--IVIQQLGYQPPSATITTRWIRQTMTEVLL 927 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 43 ESRVRDVTCACPPPTYACLVSKHP 114 +SR R ++ A P PT+A + +HP Sbjct: 91 KSRSRFLSAATPAPTHANVEDQHP 114 >AF269153-1|AAF91398.1| 109|Anopheles gambiae labial homeotic protein protein. Length = 109 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 732 PPHLGQQAPGAVNP*QSSF 676 P H AP AV+P QSSF Sbjct: 30 PNHTTVVAPSAVSPHQSSF 48 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 692 GFTAPGACCPRCGGAL 739 GF AP A CPRC G++ Sbjct: 943 GF-APSAECPRCPGSV 957 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 880,343 Number of Sequences: 2352 Number of extensions: 19968 Number of successful extensions: 74 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -