BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1491 (792 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y08110-1|CAA69325.1| 2214|Homo sapiens mosaic protein LR11 protein. 30 8.3 U60975-1|AAC50891.2| 2214|Homo sapiens gp250 precursor protein. 30 8.3 >Y08110-1|CAA69325.1| 2214|Homo sapiens mosaic protein LR11 protein. Length = 2214 Score = 30.3 bits (65), Expect = 8.3 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 28 RAAVPTQLSVIVVPVFFCLVAVILVVFGIAYYQHR 132 +AA T ++ +VVP+ F ++ + V F I Y +HR Sbjct: 2129 QAARSTDVAAVVVPILFLILLSLGVGFAILYTKHR 2163 >U60975-1|AAC50891.2| 2214|Homo sapiens gp250 precursor protein. Length = 2214 Score = 30.3 bits (65), Expect = 8.3 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +1 Query: 28 RAAVPTQLSVIVVPVFFCLVAVILVVFGIAYYQHR 132 +AA T ++ +VVP+ F ++ + V F I Y +HR Sbjct: 2129 QAARSTDVAAVVVPILFLILLSLGVGFAILYTKHR 2163 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,490,025 Number of Sequences: 237096 Number of extensions: 2166545 Number of successful extensions: 4601 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4589 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9701808132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -