BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1488 (845 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces ... 30 0.36 SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos... 29 0.83 >SPBC3D6.02 |but2||But2 family protein But2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 390 Score = 30.3 bits (65), Expect = 0.36 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -3 Query: 279 CGTVREVRQSPPLPAAWVQRMALSCSRLHGNTSCLFVLSL 160 CGT V + W+ +AL+ SR +GNT L L L Sbjct: 173 CGTQVFVGSGRSIDCQWMDSVALNLSRYYGNTEALSSLPL 212 >SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 607 Score = 29.1 bits (62), Expect = 0.83 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 772 DTPDGHVRWAVGDEEAHPLVLDEGRRR 692 DT DG V W D++ P+V D+ R R Sbjct: 121 DTKDGFVAWNTLDDDFRPIVPDQERSR 147 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,589,045 Number of Sequences: 5004 Number of extensions: 75887 Number of successful extensions: 221 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 214 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -