BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1485 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) 189 2e-48 SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) 104 8e-23 SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) 83 2e-16 SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 54 1e-07 SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) 50 1e-06 SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) 44 1e-04 SB_36816| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.094 SB_18192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_7350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_17257| Best HMM Match : rve (HMM E-Value=8.3e-08) 29 2.7 SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) 28 6.2 SB_40600| Best HMM Match : DUF667 (HMM E-Value=0.35) 28 6.2 SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) 28 8.1 SB_3531| Best HMM Match : Cytomega_US3 (HMM E-Value=6.7) 28 8.1 >SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) Length = 293 Score = 189 bits (461), Expect = 2e-48 Identities = 85/85 (100%), Positives = 85/85 (100%) Frame = +1 Query: 256 LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK 435 LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK Sbjct: 52 LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK 111 Query: 436 IKYPENFFLLRGNHECASINRIYGF 510 IKYPENFFLLRGNHECASINRIYGF Sbjct: 112 IKYPENFFLLRGNHECASINRIYGF 136 Score = 93.5 bits (222), Expect = 1e-19 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 510 YDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHG 623 YDECKRRYNIKLWKTFTDCFNCLPVAAI+DEKIFCCHG Sbjct: 137 YDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHG 174 Score = 79.4 bits (187), Expect = 3e-15 Identities = 35/54 (64%), Positives = 46/54 (85%) Frame = +2 Query: 110 DTDELNIDNVIKKLLKVRGEKPGMNVQLTEIEIKGLCLKSREIFLSQPNYLNLK 271 + ++LN+D++I +LL+VRG +PG NVQLTE EI+GLCLKSREIFLSQP L L+ Sbjct: 3 EPEKLNVDSIISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELE 56 >SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) Length = 173 Score = 104 bits (249), Expect = 8e-23 Identities = 44/82 (53%), Positives = 58/82 (70%) Frame = +1 Query: 265 LEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY 444 + +P+ +CGDIHGQ+YDL LF GG P ++Y+F+GD+VDRG SLET LL K K+ Sbjct: 42 VSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVFMGDFVDRGYYSLETFTRLLTLKAKW 101 Query: 445 PENFFLLRGNHECASINRIYGF 510 P+ LLRGNHE I ++YGF Sbjct: 102 PDRITLLRGNHESRQITQVYGF 123 Score = 56.8 bits (131), Expect = 2e-08 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = +3 Query: 510 YDECKRRY-NIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQAMEQ 656 YDEC+ +Y N W+ F+ L VAAI+D ++ C HGGLSPD++ ++Q Sbjct: 124 YDECQSKYGNANAWRYCCKVFDLLTVAAIIDGQVLCVHGGLSPDIKTIDQ 173 >SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 98.7 bits (235), Expect = 4e-21 Identities = 46/85 (54%), Positives = 58/85 (68%) Frame = +1 Query: 256 LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK 435 +LE++AP+ +CGDIHGQ+YDL++LFE GG P + YLFLGDYVDRG S+E CL Sbjct: 76 MLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIE--CL----- 128 Query: 436 IKYPENFFLLRGNHECASINRIYGF 510 Y FLLRGNHEC + + F Sbjct: 129 --YTNTLFLLRGNHECRHLTEYFTF 151 Score = 49.6 bits (113), Expect = 2e-06 Identities = 16/51 (31%), Positives = 36/51 (70%) Frame = +3 Query: 522 KRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQAMEQIRRIMR 674 K +Y+ ++ + F+CLP+AA+++++ C HGGLSP++ ++ ++++ R Sbjct: 188 KIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDR 238 >SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) Length = 199 Score = 83.0 bits (196), Expect = 2e-16 Identities = 32/58 (55%), Positives = 46/58 (79%) Frame = +1 Query: 262 ELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK 435 E++ P+ +CGD+HGQ++DL+ LF GG P++NYLF+GDYVDRG S+ET+ LL+ K Sbjct: 48 EVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLK 105 >SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 72.1 bits (169), Expect = 4e-13 Identities = 35/64 (54%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Frame = +1 Query: 211 RAMFEIKRNI-LVTA*LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVD 387 R + ++ R I L LLE+ AP+ I GDIHGQY DLLR F+ G+PP +Y+FLGDYVD Sbjct: 38 RQICQVSREIFLQQPMLLEIGAPINIFGDIHGQYEDLLRHFDKLGYPPNESYIFLGDYVD 97 Query: 388 RGKQ 399 R K+ Sbjct: 98 RPKR 101 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/49 (48%), Positives = 34/49 (69%) Frame = +2 Query: 122 LNIDNVIKKLLKVRGEKPGMNVQLTEIEIKGLCLKSREIFLSQPNYLNL 268 L++DNVI++LL + + PG VQL E +I+ +C SREIFL QP L + Sbjct: 10 LDVDNVIEQLLSYK-KNPGKQVQLPEAQIRQICQVSREIFLQQPMLLEI 57 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/48 (50%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +1 Query: 340 GFP-PESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHE 480 G P PE+ Y+F GD VDRG +S+E +L A+ I YP ++ RGNHE Sbjct: 2 GLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHE 49 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = +3 Query: 549 KTFTDCFNCLPVAAIVDEKIFCCHGGLS--PDLQAMEQIRR 665 +TF LP+A IV+ KIF HGG+S DL +E+I R Sbjct: 77 RTFRKYLGWLPLATIVNNKIFVAHGGISNITDLDIIERIDR 117 >SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) Length = 720 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +1 Query: 256 LLELEAPLKICGDIHGQYYDLL----RLFEYGGFPPESNYLFLGDYVDRGKQSLE 408 +L +++P+ + GD+HG + DL+ L+ G SN+LFLGDYVDRG+ +E Sbjct: 666 MLRVQSPVYVLGDLHGNFRDLVCFEKLLWRMGPVLTPSNFLFLGDYVDRGENGVE 720 >SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) Length = 250 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/66 (36%), Positives = 34/66 (51%) Frame = +1 Query: 283 ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL 462 + GDIHG L +LFE +FLGDYVD +S TI L+ +I + Sbjct: 7 VFGDIHGGLRALQQLFERAEITINDKLIFLGDYVDGWSESAATIQFLI--EIAEKHDCIF 64 Query: 463 LRGNHE 480 ++GNH+ Sbjct: 65 IKGNHD 70 >SB_36816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 34.3 bits (75), Expect = 0.094 Identities = 21/50 (42%), Positives = 28/50 (56%) Frame = +3 Query: 537 IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQAMEQIRRIMRPTDV 686 I+L + T F+ P +A K P++ +MEQIRRIMRPTDV Sbjct: 23 IQLQQASTAIFDYAPYSACAQRKTLA---NFPPNM-SMEQIRRIMRPTDV 68 >SB_18192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +3 Query: 504 WVYDECKR----RYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHG 623 WV EC R Y+ + KTF DC LPV +VD+ HG Sbjct: 180 WVEGECVRAMGVHYHYNISKTF-DCDYALPVFLLVDKTSHKVHG 222 >SB_7350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +3 Query: 504 WVYDECKR----RYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHG 623 WV EC R Y+ + KTF DC LPV +VD+ HG Sbjct: 63 WVEGECVRAMGVHYHYNISKTF-DCDYALPVFLLVDKTSHKVHG 105 >SB_17257| Best HMM Match : rve (HMM E-Value=8.3e-08) Length = 962 Score = 29.5 bits (63), Expect = 2.7 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 15/113 (13%) Frame = +3 Query: 393 QAVVGNNMPAPRLQD*ISR-----------EF--LSFTRKPRVCQHQ*DLWVY-DECKRR 530 +A++GN+ P P +++ + +F LS+TR QH L +E +RR Sbjct: 468 KAIIGNHYPTPTIEEVSPKLTNAKKSMQKMDFCKLSWTRHQATSQHSRHLMAAPEEFQRR 527 Query: 531 YNIKLWKTFTDCFNCLP-VAAIVDEKIFCCHGGLSPDLQAMEQIRRIMRPTDV 686 N +C LP +AA+ D+ I G+S D + +E I + +P ++ Sbjct: 528 IN--------ECIEGLPNIAAVHDDIIIYGTEGISADPEKVEAICEMQQPVNI 572 >SB_38634| Best HMM Match : DUF164 (HMM E-Value=0.6) Length = 493 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +1 Query: 385 DRGKQSLETICLLLAYKIKYPENFFLLRGNHECA 486 D KQS T+C+LL Y+ KY E + + N EC+ Sbjct: 444 DTTKQSRRTVCMLL-YRAKYIEGCY-ISVNTECS 475 >SB_40600| Best HMM Match : DUF667 (HMM E-Value=0.35) Length = 449 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = +3 Query: 465 TRKPRVCQHQ*DLWVYDECKRRYNIKLWKTFTDCFN--CLPVAAIVDEKIFCCHGGLSPD 638 +R P +H +L + E +R NI + F+ CLP+ V E+ G +SPD Sbjct: 101 SRSPLPEEHDSNLQSFLEAAKRKNI-CYNNDKSIFSTRCLPILGYVVEE-----GNISPD 154 Query: 639 LQAMEQIRRIMRPTD 683 + + +R + P+D Sbjct: 155 PERLRPLRELPVPSD 169 >SB_57048| Best HMM Match : S-antigen (HMM E-Value=3.4) Length = 242 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 406 PTTACHGPHSLRGRDSWTPEGSHHTQTTLRGH 311 PT HGPH+ +WTP G HT T H Sbjct: 202 PTRTPHGPHT---DPTWTPHGP-HTDPTRNPH 229 >SB_3531| Best HMM Match : Cytomega_US3 (HMM E-Value=6.7) Length = 519 Score = 27.9 bits (59), Expect = 8.1 Identities = 6/16 (37%), Positives = 14/16 (87%) Frame = +3 Query: 576 LPVAAIVDEKIFCCHG 623 +P++ ++D+++FCC G Sbjct: 71 VPISVVLDDRVFCCQG 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,019,682 Number of Sequences: 59808 Number of extensions: 456080 Number of successful extensions: 1398 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1284 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1396 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -