BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1476 (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 31 0.039 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 31.1 bits (67), Expect = 0.039 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 257 AMPTFIFYRNRTKIDRLEGGNTTVLENKVRQY 352 +MPTF+F + + + + G N LEN ++Q+ Sbjct: 74 SMPTFLFIKRKEVVGQFSGANAEKLENFIQQH 105 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 91 VIQNDAHFQTEMANAGTKLVVVDFTAT 171 ++++ F ++ AG +LVVVDF AT Sbjct: 4 MVKDSEDFNNKLEAAGDQLVVVDFFAT 30 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 192 RAVFLKVDVDRCADTASAQGVVQCP 266 + V +KVDVD C + A+ + P Sbjct: 52 KIVVVKVDVDECEELAAQYNIASMP 76 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,132 Number of Sequences: 2352 Number of extensions: 12244 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -