BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1475 (822 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0084 + 19899972-19900075,19900187-19900259,19900343-199004... 39 0.006 02_02_0333 + 9042393-9043610 31 1.5 09_04_0435 - 17545879-17546605,17546721-17546782,17547123-175473... 29 5.9 >11_06_0084 + 19899972-19900075,19900187-19900259,19900343-19900443, 19901502-19901637 Length = 137 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/82 (26%), Positives = 38/82 (46%) Frame = +2 Query: 263 LNNAPLGSSNQQVKENALTLTLKVLLAIKSAQIEEAVGSLSLDDIDNLMKYIYKGFEFPS 442 L PL + +++ K + + ++AI+ ++ SL + D LMKY+Y+G Sbjct: 46 LEGTPLKTRDERCKSANWIVVHRAMMAIRD--VDGMFNSLDPEYYDILMKYLYRGLSTGD 103 Query: 443 EGSSGHLLLWHDKAYSVGGLGC 508 + L H+K GLGC Sbjct: 104 RPTCDQCLKIHEKLTEKAGLGC 125 >02_02_0333 + 9042393-9043610 Length = 405 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 542 YTLILSERTLANNQDHLHCMLYHAITT 462 Y L+ S L NN +H HC+L + ++T Sbjct: 241 YYLVYSTGVLVNNNEHRHCLLMYDLST 267 >09_04_0435 - 17545879-17546605,17546721-17546782,17547123-17547335, 17547506-17547590,17547904-17548061,17548174-17548294, 17548765-17548927,17548973-17549097,17550800-17550888, 17550970-17551636,17552671-17552717,17553506-17553862 Length = 937 Score = 28.7 bits (61), Expect = 5.9 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 135 IDQYNEDNFKEDEAEQAGPTGPDEGEVCSLL--NQGRHIDA 251 +DQ E QAG G DEG+V NQG+H D+ Sbjct: 848 VDQAAEVEMLHQHQHQAGRGGWDEGDVMPFFYSNQGKHHDS 888 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,615,919 Number of Sequences: 37544 Number of extensions: 335732 Number of successful extensions: 594 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2256438528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -