BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1475 (822 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000038-1|CAA03874.1| 73|Anopheles gambiae F1 protein protein. 24 4.9 Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. 23 8.6 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 8.6 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 8.6 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 8.6 >AJ000038-1|CAA03874.1| 73|Anopheles gambiae F1 protein protein. Length = 73 Score = 24.2 bits (50), Expect = 4.9 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 132 DIDQYNEDNFKEDEAEQAGPTGPDEGE 212 D+ Y+E++F E+ + + D+GE Sbjct: 29 DVPTYDEEDFDEESLKPHSSSSSDDGE 55 >Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. Length = 101 Score = 23.4 bits (48), Expect = 8.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 132 DIDQYNEDNFKEDEAEQAGPTGPDEGE 212 D+ Y+E++F E+ + + D+GE Sbjct: 29 DVPTYDEEDFDEESLKPHSSSPSDDGE 55 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +2 Query: 557 YTAQPINETFILNFKECWFNFFICLQNDSWFSASKFYLLL 676 Y Q + ++ W+ F C+ SW S K +L+ Sbjct: 401 YMLQQVEGVGSTGYRSSWWTQFYCILWRSWLSVLKDPMLV 440 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +2 Query: 557 YTAQPINETFILNFKECWFNFFICLQNDSWFSASKFYLLL 676 Y Q + ++ W+ F C+ SW S K +L+ Sbjct: 401 YMLQQVEGVGSTGYRSSWWTQFYCILWRSWLSVLKDPMLV 440 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.4 bits (48), Expect = 8.6 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +2 Query: 557 YTAQPINETFILNFKECWFNFFICLQNDSWFSASKFYLLL 676 Y Q + ++ W+ F C+ SW S K +L+ Sbjct: 379 YMLQQVEGVGSTGYRSSWWTQFYCILWRSWLSVLKDPMLV 418 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 791,273 Number of Sequences: 2352 Number of extensions: 14520 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -